KEGG   Rothia mucilaginosa: RMDY18_13280Help
Entry
RMDY18_13280      CDS       T01144                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
rmu  Rothia mucilaginosa
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RMDY18_13280
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMDY18_13280
   00520 Amino sugar and nucleotide sugar metabolism
    RMDY18_13280
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     RMDY18_13280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1497794..1498645
Genome map
AA seq 283 aa AA seqDB search
MANYAEPGLINDLPEPTPKDLQIGVDIGGTGIKGGIVDLRTGNLVSDRFRIDTPKPATPA
AVAEVVRRVVDELQGRDLAPDPESAVGIDFPAVVKNGMVFSAANVDDSWINTDLEQVMSE
ALGGRTVYGLNDADAAGLAEATYGQGRNRDGLIAVITLGTGIGSALINNGVLIPNTELGH
LEIDGHNAESQASARAREVHELSWKKYGKRLYRYFDHVQMLFSPDLFIIGGGISKNPEKF
MPYFEDHIRTPMVMAALRNNAGIVGAALWAGGMLPERQRRGEA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctaactacgctgagcccggcctcatcaacgacctgcccgaacccacccccaaggac
ctgcagattggtgtggacattggaggcaccggcattaagggcggcatcgtcgacctgcgc
accggtaacctcgtttcggaccgtttccgcattgacacccccaagcccgcaacccccgcc
gctgtggctgaggttgtacgccgcgtagtcgacgagctgcagggtcgcgacctggcaccg
gatcccgagtccgctgtcggcatcgacttccccgcagtggtgaagaacggcatggtcttc
tccgcagctaacgtggacgattcctggattaacaccgacctggagcaggtcatgagcgag
gcgctgggcggccgtaccgtctacggtctcaacgatgctgacgcagccggtctggctgag
gcaacctacggtcagggccgtaaccgtgacggtctgattgctgtcatcaccctgggcacc
ggcatcggctccgccctcatcaacaacggcgtgctgatcccgaacaccgagctgggtcac
ctggagattgacggccacaacgccgagtctcaggcttccgcgcgtgcccgcgaggtgcac
gagctgtcctggaagaagtacggtaagcgcctgtaccgctacttcgaccacgttcagatg
ctcttctcccccgacctgttcatcattggcggcggcatctccaagaacccggagaagttc
atgccctactttgaggaccacatccgtacccctatggtcatggctgccctgcgcaataac
gccggtattgtgggcgcggcgctgtgggctggcggtatgctgcctgagcgtcagcgccgc
ggcgaagcgtaa

DBGET integrated database retrieval system