KEGG   Rothia mucilaginosa: RMDY18_13550Help
Entry
RMDY18_13550      CDS       T01144                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rmu  Rothia mucilaginosa
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RMDY18_13550
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RMDY18_13550
Enzymes [BR:rmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     RMDY18_13550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1522151..1523974)
Genome map
AA seq 607 aa AA seqDB search
MNDPVCLERIDHTELTASDSGEERRTMDTASHAPGQNLLGGDAQTLRPNSVRPVSLAHLR
EYLQGLGAQVSAQPASGVQGSESGESVEVTGISMDSRGVRPQDLYVALPGAKVHGAQFAE
AALKLGASAILTDAAGAQLLGEAPVPVLVTENLREYVGPLAALIYGSASFPATHRYAVTG
TNGKTTSTYMLESVFRTGLGVKTGLIGTIQILIDGVSVPSKMTTPESPHVHSLLTIMGQH
QVRCAAMEVSSHAIDYHRVDGVKYAVAGFTNLTQDHLDLHGTMEHYFDSKAQLFTPERAE
LAVITADDEWGEKMFSAACEQMGAQQVHRLVTARGAGLAEVPAEFGARDWAVVKVQREGL
GHRFHVDNGAGESVECYTGLPADFNVSNAALAALMAYLDTDSAERERLLPELASGSALTP
VVPGRMQLISLAPHAIVDFAHNPDGLTRALEAMDRPGDGKVMIVFGATGERDQLKRPIMG
AIAAQYADIVVVTDDDPHGEAPEPIRAAVEEGAQKAENRRATQILNISPRAAAIDAAIAL
AGEHDAILIAGRGHETEQDVDGVDIALDDRVETARALRAHGFEILPDYQRMLEESDSKTA
EGMVKND
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgaccctgtgtgccttgagcgcattgaccatacagagctcaccgcttcggacagc
ggagaggaaagaaggacgatggataccgcatctcacgcacccggccagaacctgctgggc
ggcgacgctcagactctgcgcccgaattctgtgcgcccggtgagtttggcgcaccttcgc
gaatatctgcagggcctgggtgctcaggtgagtgcccagccggctagcggcgttcagggt
tctgaatccggtgaatccgttgaggtcaccggtatcagcatggactcccgaggcgttcgc
ccacaggacctgtacgtggctctgcccggtgcgaaggtgcacggtgcgcagtttgctgag
gctgcgttgaagctgggtgcttccgctattttgacggatgctgccggtgcgcagctgctg
ggtgaggcgccggtgcctgtcctggtgactgagaacctgcgcgagtatgtcggtccgttg
gctgcgctgatttatggttcggcttcgttccccgctacccaccgttacgcggtgaccggt
acgaacggtaagaccacctccacctacatgttggagtcggtgttccgcaccggcctgggt
gtgaagacgggtctgattggcactattcagattctgattgatggtgtgtcggttccttcg
aagatgaccacccctgagtctcctcacgtgcattctctgctgacgattatgggtcagcat
caggtgcgttgcgccgcaatggaggtgtcatcgcacgcgattgattaccaccgtgtggac
ggcgtgaagtatgcggttgctggcttcacgaacctgacccaggaccacctggatttgcac
ggcactatggagcattatttcgactcgaaggctcagctgttcacccccgaacgtgccgag
ctggctgtgattactgctgatgacgagtggggcgagaagatgttctccgccgcttgcgag
cagatgggtgcgcagcaggtgcaccgtctggtgactgcgcgcggtgccggtctggctgag
gtgcccgcagagtttggtgcccgcgactgggctgtggtgaaggttcagcgtgagggtctg
ggccaccgcttccacgtggataacggtgccggtgagagcgttgaatgctacaccggtctg
cccgctgattttaacgtttcgaatgctgcgctggcggcgctcatggcgtacctggacact
gactccgctgagcgtgagcgtctgttgcccgagctggcgtccggttcggctctgactccg
gtggtgccgggtcgtatgcagctgatttctttggctccgcacgcgattgtggactttgcc
cacaaccctgacggcctgacccgtgccctggaggcgatggaccgccccggagacggcaag
gtcatgattgttttcggtgcgaccggtgagcgtgaccagctcaagcgcccgattatgggt
gcgattgcggcacagtatgcagatattgtggttgtgactgatgacgatccgcacggtgag
gcgcccgagccgattcgtgccgccgttgaggagggcgcgcagaaggctgagaaccgccga
gccacccagatcctgaatatttctccgcgtgccgccgctattgatgcggcaattgccctg
gcgggcgagcatgacgccatcctgattgctggccgcggccatgaaaccgaacaggatgtt
gacggcgtggatatcgccctggacgaccgcgttgaaaccgcccgtgccctgcgtgcgcac
ggtttcgagattctgcctgactaccagcgcatgctcgaagaaagtgactctaagaccgct
gaaggtatggtgaagaatgattaa

DBGET integrated database retrieval system