KEGG   Rothia mucilaginosa: RMDY18_13710Help
Entry
RMDY18_13710      CDS       T01144                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
rmu  Rothia mucilaginosa
Brite
Enzymes [BR:rmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     RMDY18_13710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1538002..1538868
Genome map
AA seq 288 aa AA seqDB search
MSIFDNSLEPLKRMRRKARERRLLATQNVKDSLARRLEGDQEAFDHSPVSFSPDPAQHSV
GILLVHGFTGSPHSMRPLAQHFMELGYAVEMPLLTGHGTHWKDLRDSTYEQWLASAEQGY
RRLADQGLRVVVIGMSMGGTVATHLSARLPVAGTVLINPYMVDVNPMMRHAGKVSKVLPV
LKAIGSDIAVPGVSEGAYSIVPTAAVHQLHLLGAETRALIPQLKSPVLYLRSLGDHTVSD
SSHKYFLEHCSVPVEFRWLTRSYHVATLDYDAEYLLSTVQAFVASLNH
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttttgataactcgttggagccgctcaagcggatgcgccgcaaggctcgcgag
cgcaggcttctagcgacccaaaatgttaaggactccctggcgcgtcgcctcgagggcgac
caggaagcgttcgatcactcccccgtttcttttagtcctgacccggcgcagcattctgtg
ggtattttgctggtgcacggttttacgggttcaccgcatagcatgcgcccgttggctcag
cattttatggagctcgggtatgcggtggagatgccgttgctgaccggtcacggtactcat
tggaaagatttgcgcgatagcacctatgagcagtggctagcttctgccgagcaggggtac
cgtcgcctagccgatcagggtctgcgtgtggtggtcattggtatgtcgatgggcggcacg
gtggcgacccatctgtcggcgcgcctgccggtggcgggtacggtactcatcaacccctac
atggtggatgtgaacccgatgatgcgtcacgccggtaaggtgtcgaaggttctgccggtg
ctcaaggcgattggttccgatattgcggttccgggtgtgagcgagggcgcgtattctatc
gttccaacggcagcagtgcatcagctacatcttttgggtgctgagactcgtgctctgatc
ccgcagttgaagtcgccggttctgtatttgcgttcactgggcgatcatactgtgtcggat
agctcccataaatattttctcgaacattgttcagttcctgtagaatttaggtggctgacc
cgcagctaccatgtggcaacgctcgactacgacgccgagtatcttctctctactgttcaa
gcttttgtcgcatcactaaaccactaa

DBGET integrated database retrieval system