KEGG   Rothia mucilaginosa: RMDY18_13860Help
Entry
RMDY18_13860      CDS       T01144                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rmu  Rothia mucilaginosa
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RMDY18_13860
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RMDY18_13860
Exosome [BR:rmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RMDY18_13860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1558956..1560632
Genome map
AA seq 558 aa AA seqDB search
MGSGCWPDHRRYPRRPDRSGSSAPLNLSNIPPFFCSKEKSMTTSLHSATLNVERKYILSI
DQGTTSSRAILFNKAGENVAHGQLEHEQIFPKAGWVEHNATEIWQNVRKVVAMAMANGEV
NHHEIAAVGITNQRETTVVWDKNTGEPVYNAIVWQDTRTQEIVEELAGEEGVGKYHDIVG
LNLSTYFSGPKIKWILDNVEGARERAERGDLLFGNTDTWLVWNLTGGVDGGVHVTDVTNA
SRTLLMDIRTLEWDPQIAADMGIPMSMLPEIKSSSEVYGFGRATGLLSGTPIAGILGDQQ
AATFGQACFEKGMAKNTYGTGNFMLMNTGNEPVFSNNGLLTTVAYKIGDAAPVYALEGSV
AMSGSLIQWLRDNLRMIEHAAESEELATSVKDSGGCYVVPAFSGLFAPHWRSDARGVIVG
LTRYVNRAHIVRAALEATAFQTREVLDAMNADSGVELSELRVDGGMTANEFLMQFQADIL
GVPVIRPKVVETTALGAAYAAGIAVGFWSGEQDVVDNWAEDKRWLPSMEPAEVDRQYRLW
KKAVSRTLEWVDEDVPTA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgggttccggttgttggcccgatcatcggcgctatcctcgcaggcctgatcgttccggc
agttctgcccctctaaacctctctaatatccccccgttcttttgttctaaggaaaaatca
atgacgacttctctgcactccgcaaccctcaacgtcgagcgcaagtacatcctctccatc
gaccagggcaccaccagctcccgcgcgatcctgttcaacaaggcaggcgagaacgtagcg
cacggtcagctcgagcacgagcagatcttccccaaggcaggctgggtcgagcacaacgca
accgaaatttggcagaacgtccgtaaggtcgtagcaatggctatggcaaacggcgaagtc
aaccaccacgaaatcgctgcagtcggcatcaccaaccagcgcgaaaccaccgtcgtgtgg
gacaagaacaccggtgagcccgtctacaacgcaatcgtctggcaggacacccgcacccag
gaaatcgttgaagagctcgcaggcgaagagggcgttggcaagtaccacgacatcgtcggc
ctgaacctctctacctacttctccggccccaagatcaagtggatcctggacaacgttgaa
ggcgcacgcgagcgcgcagaacgcggcgacctgctcttcggcaacaccgacacctggctg
gtctggaacctgaccggtggtgttgacggcggcgtgcacgtcaccgacgtaaccaacgca
tcccgcaccctgctgatggacatccgcaccctcgaatgggatccgcagattgctgcagac
atgggtatccccatgagcatgctgcccgagatcaagtcctcctccgaggtgtacggcttc
ggtcgcgcaaccggtctgctcagcggcacccccatcgcgggtatcctcggcgaccagcag
gctgcaaccttcggtcaggcttgcttcgagaagggcatggcgaagaacacctacggtacc
ggtaacttcatgctcatgaacaccggcaacgagcccgtcttctccaacaatggtctgctg
accaccgtcgcatacaagattggcgatgcagcacccgtctacgctctggaaggctcggtc
gcaatgagcggctccctgatccagtggctgcgcgacaacctgcgcatgattgagcacgct
gcagagtctgaggaactggccacctccgtcaaggactccggcggctgctacgttgttccc
gcattctccggcctgttcgcacctcactggcgttccgacgctcgcggcgtcatcgttggt
ctgacccgctacgtgaaccgtgcacacatcgtgcgtgcggcactggaagcaaccgcattc
cagacccgcgaggttctggacgcaatgaacgctgactccggtgttgagctctccgagctg
cgcgtggacggcggcatgaccgctaacgagttcctcatgcagttccaggctgacatcctc
ggcgttcccgtaatccgcccgaaggttgttgagaccaccgctctgggcgcagcatacgct
gcaggtatcgctgttggtttctggagcggcgagcaggacgttgtggacaactgggctgag
gacaagcgctggctgccctccatggagcccgcagaggttgaccgccagtaccgcctgtgg
aagaaggctgtctcccgcaccctcgagtgggttgacgaggacgttccgaccgcctaa

DBGET integrated database retrieval system