KEGG   Rothia mucilaginosa: RMDY18_14920Help
Entry
RMDY18_14920      CDS       T01144                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00900  Terpenoid backbone biosynthesis
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RMDY18_14920
Enzymes [BR:rmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     RMDY18_14920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: BAI65324
UniProt: D2NNV6
Position
complement(1673077..1674402)
Genome map
AA seq 441 aa AA seqDB search
MKFGSSARVGGSRDRLTDALTELTRAPQRVTLLGSTGSIGTQAMEVIDHLAALKGTSASA
ADAPLKVVALSAGSRSLELLARQAVHVRAELVATSGTAEDAQRLRGLIEAAASEAGVTGY
TPQIAHGAEASVQAAAHPADTVLNGITGSIGLEPTLTALNSGYRVALANKESLIAGGPLV
RAAVDASPLDTPMVPVDSEHSALAQALASGTDAEIDRLILTASGGPFRGYKREQLHDVTP
AQALAHPTWDMGLVVTTNSATMVNKALEVLEAHHLFGVDLDRIDVAVHPQSIVHSMVQFV
DGSTIAQASPPSMVLPIALGLTWPHRIPGAVPACDWSKAASWTFEPLDEEAFPAVRMIKD
AGKVGGTHPAVFNAANEEAVAAFHAGAIRFTDIVDSVARVLEKHTGSAEAVSDADLTLDA
VLNAERWARVRANELLGMTGR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttggatcctcagcacgcgtcggcggcagccgcgaccgcctcaccgacgccctc
acagaactcacccgcgcaccgcagcgcgtcaccctcctcggctcaaccggctccatcggc
acccaagccatggaagtcatcgaccacctcgccgcactcaaaggcaccagcgcctccgcc
gccgacgcaccgctgaaggtcgtcgccctctccgcaggctcccgatccctcgaactactc
gcacgccaggcagtgcacgtgcgcgccgaactggtcgccaccagcggcactgcagaagac
gcgcagcgcctccgcggactcatcgaggcggcagcctccgaagcaggcgttaccggctac
accccgcagatcgcccacggtgccgaagcctccgtacaggcggcagcacacccggcagac
accgtcctcaacggcatcaccggctccatcggcctggaaccgaccctcaccgccctcaac
agcggctaccgagtggcactggccaacaaggaatccctcatcgcaggcggcccgctcgta
cgcgccgccgtcgacgcatcccccctggacacccccatggtgcccgtcgactccgaacac
tccgccctcgcgcaggcgctcgcctccggaaccgacgcagaaatcgaccgactcatcctc
accgcatcgggcggcccgttccgcggctacaagcgcgaacagctgcacgacgtgaccccc
gcgcaggcgctcgcacaccccacctgggacatgggcctggtcgtcaccaccaactcggca
accatggtcaacaaggcactcgaagtgctcgaggcgcaccacctgttcggcgtggacctg
gaccgtatcgacgtggcggttcacccgcagtccatcgtgcactccatggtgcagtttgta
gacggctccaccattgcgcaggcgtccccgccgagcatggttctgcccatcgcgctgggt
ctgacctggccgcaccgcatccccggtgccgtgcctgcttgcgactggtcgaaggcggca
tcctggacttttgagccgctggacgaggaagcattccccgccgtgcgcatgatcaaggac
gccggcaaggtcggcggcactcacccggcagtgttcaacgccgccaatgaggaagccgtg
gcagcattccatgcgggcgcgattcgctttaccgacattgtcgattcggtcgcacgcgtg
ctggagaagcacaccggcagcgctgaggctgtctctgacgctgatttgactctggatgcg
gtgctgaacgcggagcgttgggctcgcgttcgcgcgaatgagctgctgggcatgaccgga
cgctaa

DBGET integrated database retrieval system