KEGG   Rothia mucilaginosa: RMDY18_15960Help
Entry
RMDY18_15960      CDS       T01144                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rmu  Rothia mucilaginosa
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RMDY18_15960
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RMDY18_15960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1797734..1798753)
Genome map
AA seq 339 aa AA seqDB search
MYALMSTASQTAISVDAPGKVNLYLAVGDVRPDGYHPLTTLFAAVSLTETITVSEGQAPG
LSLSMDIVPGSLVDQQMQAGQFDPAAVPMDERNLVYHAAALILAEHGIESVPALHLHIAK
AVPVAGGMAGGSADAAAALIATDRYLHATGRTGALLTQTDYERLAAQLGADIPFSVRAAL
GQTLALGQGTGTELQNIAAPREPLHLVIVAAQFGLSTPSVFKQLDAGRASGLYPASGKLV
EPVELLSTLNSYDGSEAALASLAPLLRNDLQAPALSCAPQLEQTLNLRESEGVYASLVSG
SGPTVLLLVSSQTRAEALASTLRAAGNHAVSAVSAILHH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgcgctgatgagtaccgcctcccagaccgctatttcggttgatgctcccggcaag
gtcaatctgtaccttgccgtgggggatgttcgtccggacggctaccacccgttgactacg
ctttttgcggcggtctctttgacggagaccatcacggtctctgaggggcaggcaccgggg
ctgagcttgagcatggatattgtgcccggctccctggtagatcagcagatgcaggcgggg
cagttcgaccctgccgctgtgccaatggatgagcggaatcttgtgtaccatgccgctgcg
ctgattcttgcggagcacggcatcgaatctgtcccggcgctgcacctgcatattgcgaag
gctgtgcccgtggctggcggtatggctggcggctcagcggacgcggctgctgccctcatt
gctacggaccgctacctgcacgcaaccggccgcaccggtgcgctcctgacccagacggat
tatgaacgtcttgccgcgcaactgggcgccgatattccctttagcgtgcgtgccgcgctc
gggcagaccctcgcactggggcaggggaccggtaccgagctgcagaatattgcggcgcct
cgggaacctctgcacctggtgattgttgccgcgcagtttggcctctccacccccagcgta
ttcaagcagctggacgcgggccgcgcctcggggctgtaccctgcctcaggcaagctggtg
gaacccgtagagcttctgagcaccctgaattcttatgatggttcggaggcggcgctcgcc
tccttggcaccgctgctacgtaacgacctgcaggctcccgcgctttcgtgcgccccgcag
ctggaacagaccctgaacctgcgcgagagtgagggcgtgtacgcctccctggtgtccggt
tccggtccgacggtgcttctgctggtttcttcgcagactcgggcggaggctcttgcctcc
actcttcgcgctgcgggcaaccacgcggtcagcgcggttagtgcgattctgcatcattag

DBGET integrated database retrieval system