KEGG   Rothia mucilaginosa: RMDY18_16380Help
Entry
RMDY18_16380      CDS       T01144                                 

Definition
enolase
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
rmu  Rothia mucilaginosa
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rmu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rmu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rmu00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:rmu00680]
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:rmu03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1837900..1839180)
Genome map
AA seq 426 aa AA seqDB search
MAVITAVHARQILDSRGNPTVEVEVLLEDGAFARAAVPSGASTGEWEAVERRDGDKSVYL
GKGVLGAVKSVIEEIAEEVIGIEASDQRAVDAAMIALDATNNKGKLGANAILGVSLAVAK
AAAESADLPLYKYLGGPNAHVLPVPMMNILNGGSHADSNVDIQEFMIAPIGFDNYSDALR
AGVEVYHSLKSVLHDRGLATGLGDEGGFAPNLESNAAALDLIVEAIEKAGYKPGEQVALA
LDVASSEFYNDGAYEFEGQKKSAAEMSAYYADLVAKYPLVSIEDPLDENDWEGYKTLTEQ
IGDKVQIVGDDLFVTNPERLARGIEEGAANALLVKVNQIGSLTETLDAMELAQRHEYRCM
VSHRSGETEDVTIADLAVATNAGQIKTGAPARSERVAKYNQLLRIEEELGEAAVYAGKSA
FPRFKA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctgttattaccgcagttcacgcacgccagatcctggattcccgtggcaacccgacc
gttgaggttgaggttctgctcgaagacggtgctttcgcacgcgcagctgtgccctcgggc
gcatccaccggtgagtgggaagctgttgagcgccgcgatggcgacaagtccgtatacctg
ggcaagggtgttctgggcgcagtgaagtctgttatcgaagaaatcgctgaagaggtcatc
ggcattgaggcttccgaccagcgcgctgttgacgcagccatgatcgctctggatgcaacc
aacaacaagggcaagctgggtgcaaacgcaatcctgggtgtctccctggctgttgctaag
gctgctgctgagtccgctgacctacccctgtacaagtacctcggtggcccgaacgctcac
gttctgcccgtccccatgatgaacatcctcaacggtggttctcacgcagactccaacgtt
gacattcaggagttcatgattgctcccatcggcttcgacaactactctgacgctctgcgc
gcaggtgttgaggtttaccactccctgaagtccgtgctgcacgaccgcggcctggcaacc
ggcctgggcgacgagggtggcttcgcacccaacctggagtccaacgcagctgcactggac
ctgattgttgaggcaatcgagaaggctggctacaagccgggcgagcaggttgcactggct
cttgacgttgcttcctccgagttctacaacgacggcgcatacgagttcgagggccagaag
aagtccgcagctgagatgagcgcatactacgctgacctcgttgcaaagtacccgctggtt
tccatcgaggatcccctggatgagaacgactgggagggctacaagaccctgaccgagcag
atcggtgacaaggtccagatcgtcggtgacgacctgttcgtgaccaaccccgagcgtctg
gctcgcggtatcgaagagggcgcagctaacgctctgctcgtgaaggtgaaccagatcggt
tcgctgaccgagaccctcgacgcaatggagctggcacagcgccacgaataccgttgcatg
gtttctcaccgttccggtgagaccgaggacgtcaccatcgccgacctggctgttgcaacc
aacgctggccagatcaagaccggtgctcccgcacgttccgagcgcgttgctaagtacaac
cagctgctgcgcattgaggaagagctgggcgaggcagctgtttacgctggcaagtccgca
ttcccccgcttcaaggcataa

DBGET integrated database retrieval system