KEGG   Rothia mucilaginosa: RMDY18_16450Help
Entry
RMDY18_16450      CDS       T01144                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rmu  Rothia mucilaginosa
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RMDY18_16450
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RMDY18_16450
   00650 Butanoate metabolism
    RMDY18_16450
  Energy metabolism
   00190 Oxidative phosphorylation
    RMDY18_16450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1848609..1849094)
Genome map
AA seq 161 aa AA seqDB search
MATPLKPRTYVPRLRDNRIDGVKYNRSSSKRNNFEMFAWLGMRLSGVVLVVLIFGHLFSN
LMVGDGIHAIDFGFVGGKWANPFWQVWDLLLLWLAMLHGANGIRVIIDDYAEKDRLRIWL
KVILFAACAFVLLVGTLTIFAFDPCPSGAAANLLPSFCSAR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggctactccgcttaagccccgcacctatgtaccccgtctgcgtgacaaccgcatcgac
ggtgtgaagtacaaccgctcctcctccaagcgcaacaactttgagatgttcgcttggctg
ggtatgcgcctgtccggcgtcgtactcgtcgtgctgattttcggtcacctgttctccaac
ctcatggtcggcgacggcatccacgccatcgacttcggcttcgtgggcggcaagtgggcg
aaccccttctggcaggtctgggatctgctgctgctctggctggctatgctgcacggtgct
aacggtatccgcgtcatcatcgatgactacgctgagaaggaccgcctgcgtatttggctg
aaggtcatcctcttcgcagcatgcgcattcgtcctgctggttggtaccctcaccatcttc
gcattcgacccctgcccctcgggcgcagcggctaatctgcttcccagcttctgctcggca
cgctaa

DBGET integrated database retrieval system