KEGG   Rothia mucilaginosa: RMDY18_17340Help
Entry
RMDY18_17340      CDS       T01144                                 

Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rmu  Rothia mucilaginosa
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RMDY18_17340
   01230 Biosynthesis of amino acids
    RMDY18_17340
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMDY18_17340
  Energy metabolism
   00680 Methane metabolism
    RMDY18_17340
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RMDY18_17340
Enzymes [BR:rmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RMDY18_17340
Exosome [BR:rmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RMDY18_17340
  Exosomal proteins of melanoma cells
   RMDY18_17340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1951507..1952244)
Genome map
AA seq 245 aa AA seqDB search
MTYKLVLLRHGQSEWNEKNLFTGWVDVNLTDKGRAEAKRGGELLAERNILPDVVHTSLQR
RAINTANLALDAADRLWIPVKRTWRLNERHYGALQGKNKSEIREEYGDEKFMTWRRSYDV
PPPPLDDNDPYSQANDPRYADVENAPRTECLKDVLGRMLPYWESDIKPDLAAGKTVLVAA
HGNSLRSLVKHLEGISDEDIAGLNIPTGIPLYYELDENFQPVKAGEYLDPEAAKDAIAAV
ANQGK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaaactagtactcctgcgccacggccagtccgagtggaacgagaagaacctg
ttcaccggctgggtggacgttaacctgaccgataagggccgcgctgaggctaagcgcggc
ggcgagctgctggcagagcgcaacatcctccccgatgttgttcacacctccctgcagcgt
cgcgcaatcaacaccgcaaaccttgcactggatgcagcagaccgtctgtggattcccgtc
aagcgcacctggcgcctgaacgagcgtcactacggtgctctgcagggtaagaacaagtcc
gagatccgcgaggaatacggcgacgagaagttcatgacttggcgtcgttcctacgacgtt
ccgccgcccccgctggacgacaacgacccctactcgcaggcaaacgacccccgctacgcg
gatgttgagaacgctccccgcaccgagtgcctgaaggacgttctgggccgtatgcttccc
tactgggagtcggacatcaagcccgacctcgcagcaggtaagaccgttctggttgctgca
cacggtaactccctgcgttcgctggttaagcacctcgagggtatttccgatgaggacatt
gctggcctgaacatccccaccggtattccgctgtactacgagctggatgagaacttccag
cccgtcaaggctggcgagtacctggaccccgaggctgctaaggacgctattgctgccgta
gcaaaccagggcaagtaa

DBGET integrated database retrieval system