KEGG   Rothia mucilaginosa: RMDY18_17720Help
Entry
RMDY18_17720      CDS       T01144                                 

Definition
recombinational DNA repair protein
Orthology
K06187  
recombination protein RecR
Organism
rmu  Rothia mucilaginosa
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RMDY18_17720
DNA repair and recombination proteins [BR:rmu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RMDY18_17720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1998061..1999215
Genome map
AA seq 384 aa AA seqDB search
MYEGAVQNLIDELGRLPGVGPKSAQRIAFHILNADAADMARLANAISTVKTSVSFCEECG
NVSETKLCTICRDERRDPSVLCVVEESKDVVAIERTRSFTGRYHVLGGAINPLAGVGPEQ
LRIRELVSRLADERIQEIILAMDPNLEGEATATYLSRMLVPLGVRLSRLASGLPVGGDLE
YADEITLGRALEGRRVISEGTAVAHTAAEDFERVNREQEQEREQAAQVQAQEAKQSRRRW
NSSMFDDLDSEDSAGSRTEAPTAEGVQGTVDEQLIEQVLQEAEESGEEASPTDSGAGSTP
EATEAEATPDLGEDSAEEAPASAAPDPAEAPTEAPATEQSEDAPEVFRTPDYEEKIRSIQ
NAPLRTPKPDVPPLPGVTYVNPWT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagggagcagttcaaaacctcattgacgagctcggccgcctgccgggtgtgggc
cccaagtcggctcagcgcatcgcttttcacattctgaatgcggatgctgccgatatggcg
cgcctagccaacgccatttccacggtgaagaccagcgtgagcttctgtgaggagtgcggt
aacgtctccgagacgaagctgtgcacaatctgtcgtgatgagcgccgcgacccgtccgtg
ctgtgtgtggtcgaggagtcgaaggacgtggtggcgattgagcgcacccgttcctttacc
ggccgctaccatgtgcttggcggtgccattaacccgctggcgggtgtgggcccggagcag
ctgcgtattcgtgagctggtgtcccgcctggcggatgagcgtatccaggagattattctg
gcgatggacccgaaccttgagggtgaggcgaccgcaacctacctttcgcgtatgctcgtg
ccgctgggtgtgcgtctgtcgcgtctggcgtcgggcctgccggtcggtggcgatttggag
tacgcggacgagattaccctgggccgcgcgctggagggccgccgcgtcattagcgagggc
acggcggtggctcatactgccgccgaggattttgagcgcgtgaaccgtgagcaggagcag
gagcgtgagcaggcggctcaggttcaggctcaggaggcgaagcagagtcgtcgccgctgg
aattcgagcatgtttgatgacctggattctgaggattctgccggttcccgcacggaggcg
cccaccgccgagggtgtgcagggcacggtggatgagcagctgattgagcaggttctgcag
gaggctgaggaatcaggcgaggaagcctcccccaccgattctggtgcgggctctacgcct
gaagccacagaagcagaagcaacccctgacttgggcgaagattccgccgaggaggctccg
gcgagcgccgcccccgaccccgcagaagcacccactgaggcacccgcaaccgagcagtcg
gaggacgctccggaggtgttccgcacccccgattatgaggagaagatccgctcgattcag
aacgccccgttgcgcaccccgaagccggatgttccgccgctaccaggtgtcacttacgtg
aacccgtggacctaa

DBGET integrated database retrieval system