KEGG   Rothia mucilaginosa: RMDY18_18340Help
Entry
RMDY18_18340      CDS       T01144                                 

Definition
acyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rmu  Rothia mucilaginosa
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rmu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rmu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rmu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rmu00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rmu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2066962..2069115
Genome map
AA seq 717 aa AA seqDB search
MLMPATDGRKMGLPTPYSFTDPLNPTPNPALESDEARVAFWEKQAQRLTWAEPWHTAHRF
EKPKSLGFDEDGIEQFSIPEIKWFEGGKLNVAYNCVDRHVEAGRGDKVALYFEGEPGDRE
AITYAELQRRIAKAANGLLSLGVRKGDRVVIYLPVIPETIIFTLACARIGAIHSLVFGGF
SAEALKFRVEDTGAKVLITTDGQNRRGKVVPVKVNADEACSGENNIEHVIVVDRTSASDP
VEHAAVPWTEGRDVWYHDLVDDQPDTHAYELHDAEDPLFIIYTSGTTGKPKGLVHTMAGY
LVQTAYTHALLYDLLPDYVDENGVLRPDELSAVNDPEKVESTVHWCTADLAWVTAHTYEI
YGPLVNGVSEVIYEGTPNTPHFGRHFEVIERYGVTNYYTAPTLIRSLMGAFPNGPEPGKY
DFSTVRLLGSVGESINPEAWRWLRQHVGGGTAAFIDTWWQSETGSTVCSPRPHDPAFAPE
GTYPEGTPHCTPLPGCATRAVPGVSTRVVDEHGDPVEPGKQGFIVVDKIGPSMARTVWQN
PQRFLDSYWRHYGERGWFLAGDGAKEDEEGNVYILGRIDDVINISGHRLSTIEIESALVT
HPAVVEAGVCPVEDELTGHQAVAYVTLTDEGKDLTEDELKAALTAHVREHIGPIAKPKDV
VAVADIPKTRSGKITRRLLGELYQGRSLGDVSSLQNEEALGHIAQVLVDTGRVSEAV
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatgccagcaaccgatgggagaaaaatgggactgcccaccccctactcgttcacc
gacccgctgaaccccaccccgaaccccgccctcgaatctgacgaggcacgcgtcgcgttc
tgggagaagcaggcgcagcgcctcacctgggctgagccctggcacaccgcgcaccgtttc
gagaaaccgaagtccctcggcttcgacgaggacggcatcgaacagttcagcatccccgaa
attaagtggttcgagggcggtaagctcaacgtcgcttacaactgcgtggaccgccacgtg
gaggcgggccgcggcgacaaggtagccctctactttgaaggtgaacccggagaccgcgaa
gccatcacctacgcagagctgcagcgccgcatcgcgaaggcagcgaacggtctgctgtcc
ctgggcgtgcgcaagggtgaccgtgtggtcatctacctgcccgtcatccccgaaaccatt
attttcactctcgcctgcgcgcgtattggcgcgatccattccctcgtcttcggtggtttc
tccgctgaggcgctgaagttccgtgtggaagacaccggcgcgaaggttctcatcaccacc
gacggtcagaaccgccgcggcaaggtcgttcccgtgaaggtgaacgccgacgaagcttgc
tccggtgagaacaatattgagcacgttatcgtggtggaccgcaccagtgcctccgacccg
gtggagcacgccgctgtgccgtggactgagggccgcgacgtctggtaccacgacctggtg
gacgaccagccggacacccacgcctacgaactgcacgacgccgaggacccgctgttcatt
atttacacctccggcacgaccggtaagcccaagggcctggtgcacaccatggctggatac
ctggtgcagaccgcgtacactcacgcgctgctctacgatttgctgccggattacgtggac
gagaacggcgtgctgcgcccggacgagctgtccgcggtcaacgacccggaaaaggttgag
tccaccgttcactggtgcaccgccgacctggcgtgggttaccgcgcacacctacgaaatc
tacggcccgctggttaacggtgtctccgaggtgatttacgagggtaccccgaacaccccg
cacttcggccgccactttgaggtcatcgaacgctacggcgtgaccaactactacaccgcc
ccgaccctgattcgttccctcatgggtgcgttcccgaacggcccggagcccggcaagtac
gacttctcgaccgtgcgtctgctcggttcggtgggtgaatccattaacccggaggcgtgg
cgttggctgcgtcagcacgtgggcggcggcaccgcggcgttcatcgacacctggtggcag
tccgagaccggttcgaccgtatgctccccgcgcccgcacgacccggcattcgcgcccgag
ggcacctacccggagggcaccccgcactgcactcccctgcccggttgcgctacccgcgcc
gttcccggcgtgtccacccgcgtggtggatgagcacggcgacccggtcgaacccggcaag
cagggcttcatcgtggtcgataagattggcccctcgatggctcgtaccgtgtggcagaac
ccgcagcgtttcctggattcctattggcgtcactacggcgagcgcggctggttcctcgct
ggcgacggcgcgaaggaagacgaagagggtaacgtgtacatcctcggccgtattgatgac
gtgattaacatttcgggtcaccgcctgtccacgattgagattgagtcggctctggtgact
cacccggctgtggttgaggctggtgtctgccccgtggaggatgagctgaccggtcaccag
gcggtcgcctacgtgacgctcaccgatgagggtaaggacctgactgaggatgagctgaag
gcggcgctgaccgcgcacgtgcgtgagcacattggcccgattgctaagccgaaggacgtt
gtggcggttgccgatatcccgaagacccgttcgggtaagattactcgccgtctgctcggt
gagctgtaccagggccgttcgctgggcgatgtttcttcgctgcagaatgaggaggcgctg
ggccacattgcgcaggtgctggtggataccggccgcgtgagcgaggctgtctag

DBGET integrated database retrieval system