KEGG   Rothia mucilaginosa: RMDY18_18340Help
Entry
RMDY18_18340      CDS       T01144                                 

Definition
acyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rmu  Rothia mucilaginosa
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RMDY18_18340
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMDY18_18340
   00620 Pyruvate metabolism
    RMDY18_18340
   00640 Propanoate metabolism
    RMDY18_18340
  Energy metabolism
   00680 Methane metabolism
    RMDY18_18340
Enzymes [BR:rmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RMDY18_18340
Lipid biosynthesis proteins [BR:rmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RMDY18_18340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2066962..2069115
Genome map
AA seq 717 aa AA seqDB search
MLMPATDGRKMGLPTPYSFTDPLNPTPNPALESDEARVAFWEKQAQRLTWAEPWHTAHRF
EKPKSLGFDEDGIEQFSIPEIKWFEGGKLNVAYNCVDRHVEAGRGDKVALYFEGEPGDRE
AITYAELQRRIAKAANGLLSLGVRKGDRVVIYLPVIPETIIFTLACARIGAIHSLVFGGF
SAEALKFRVEDTGAKVLITTDGQNRRGKVVPVKVNADEACSGENNIEHVIVVDRTSASDP
VEHAAVPWTEGRDVWYHDLVDDQPDTHAYELHDAEDPLFIIYTSGTTGKPKGLVHTMAGY
LVQTAYTHALLYDLLPDYVDENGVLRPDELSAVNDPEKVESTVHWCTADLAWVTAHTYEI
YGPLVNGVSEVIYEGTPNTPHFGRHFEVIERYGVTNYYTAPTLIRSLMGAFPNGPEPGKY
DFSTVRLLGSVGESINPEAWRWLRQHVGGGTAAFIDTWWQSETGSTVCSPRPHDPAFAPE
GTYPEGTPHCTPLPGCATRAVPGVSTRVVDEHGDPVEPGKQGFIVVDKIGPSMARTVWQN
PQRFLDSYWRHYGERGWFLAGDGAKEDEEGNVYILGRIDDVINISGHRLSTIEIESALVT
HPAVVEAGVCPVEDELTGHQAVAYVTLTDEGKDLTEDELKAALTAHVREHIGPIAKPKDV
VAVADIPKTRSGKITRRLLGELYQGRSLGDVSSLQNEEALGHIAQVLVDTGRVSEAV
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatgccagcaaccgatgggagaaaaatgggactgcccaccccctactcgttcacc
gacccgctgaaccccaccccgaaccccgccctcgaatctgacgaggcacgcgtcgcgttc
tgggagaagcaggcgcagcgcctcacctgggctgagccctggcacaccgcgcaccgtttc
gagaaaccgaagtccctcggcttcgacgaggacggcatcgaacagttcagcatccccgaa
attaagtggttcgagggcggtaagctcaacgtcgcttacaactgcgtggaccgccacgtg
gaggcgggccgcggcgacaaggtagccctctactttgaaggtgaacccggagaccgcgaa
gccatcacctacgcagagctgcagcgccgcatcgcgaaggcagcgaacggtctgctgtcc
ctgggcgtgcgcaagggtgaccgtgtggtcatctacctgcccgtcatccccgaaaccatt
attttcactctcgcctgcgcgcgtattggcgcgatccattccctcgtcttcggtggtttc
tccgctgaggcgctgaagttccgtgtggaagacaccggcgcgaaggttctcatcaccacc
gacggtcagaaccgccgcggcaaggtcgttcccgtgaaggtgaacgccgacgaagcttgc
tccggtgagaacaatattgagcacgttatcgtggtggaccgcaccagtgcctccgacccg
gtggagcacgccgctgtgccgtggactgagggccgcgacgtctggtaccacgacctggtg
gacgaccagccggacacccacgcctacgaactgcacgacgccgaggacccgctgttcatt
atttacacctccggcacgaccggtaagcccaagggcctggtgcacaccatggctggatac
ctggtgcagaccgcgtacactcacgcgctgctctacgatttgctgccggattacgtggac
gagaacggcgtgctgcgcccggacgagctgtccgcggtcaacgacccggaaaaggttgag
tccaccgttcactggtgcaccgccgacctggcgtgggttaccgcgcacacctacgaaatc
tacggcccgctggttaacggtgtctccgaggtgatttacgagggtaccccgaacaccccg
cacttcggccgccactttgaggtcatcgaacgctacggcgtgaccaactactacaccgcc
ccgaccctgattcgttccctcatgggtgcgttcccgaacggcccggagcccggcaagtac
gacttctcgaccgtgcgtctgctcggttcggtgggtgaatccattaacccggaggcgtgg
cgttggctgcgtcagcacgtgggcggcggcaccgcggcgttcatcgacacctggtggcag
tccgagaccggttcgaccgtatgctccccgcgcccgcacgacccggcattcgcgcccgag
ggcacctacccggagggcaccccgcactgcactcccctgcccggttgcgctacccgcgcc
gttcccggcgtgtccacccgcgtggtggatgagcacggcgacccggtcgaacccggcaag
cagggcttcatcgtggtcgataagattggcccctcgatggctcgtaccgtgtggcagaac
ccgcagcgtttcctggattcctattggcgtcactacggcgagcgcggctggttcctcgct
ggcgacggcgcgaaggaagacgaagagggtaacgtgtacatcctcggccgtattgatgac
gtgattaacatttcgggtcaccgcctgtccacgattgagattgagtcggctctggtgact
cacccggctgtggttgaggctggtgtctgccccgtggaggatgagctgaccggtcaccag
gcggtcgcctacgtgacgctcaccgatgagggtaaggacctgactgaggatgagctgaag
gcggcgctgaccgcgcacgtgcgtgagcacattggcccgattgctaagccgaaggacgtt
gtggcggttgccgatatcccgaagacccgttcgggtaagattactcgccgtctgctcggt
gagctgtaccagggccgttcgctgggcgatgtttcttcgctgcagaatgaggaggcgctg
ggccacattgcgcaggtgctggtggataccggccgcgtgagcgaggctgtctag

DBGET integrated database retrieval system