KEGG   Rattus norvegicus (rat): 100216475Help
Entry
100216475         CDS       T01003                                 

Gene name
Hexdc
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing (EC:3.2.1.52)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
rno  Rattus norvegicus (rat)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:rno00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10
AA seq 486 aa AA seqDB search
MTCSTPFKMRLVHLDLKGAPPKVSYLSEVFPLFHALGANGLLIEYEDMFPYEGHLRLLRA
KHAYSPSEVTEILRLARLSGLEVVPLVQTFGHMEFVLKHAAFAHLREVAPFPNTLNPHEA
ESLALVQAMIDQILELHRDVRWLHIGCDEVYYLGEGETSKQWLQQEQNSHAKLCLNHMQA
VASHVLTQHPGITPLVWDDMLRDIPQEQLKASGVPQLVEPVLWDYGADLDVHSKNFLIGK
YQECGFQRLWAASAFKGATGASQALPPVEHHIRNHELWLQVAGSGPVDTLQGIILTGWQR
YDHFSVLCELLPVGIPSLAACLQSLVHGGFAEDVRLRVERFLGVSSLEITDTVSEGAGSF
PGSDIHALVTQISLHLRSSVDSLLERNRYVTGWFSPYHRRRKLVHPVMIQHIQPEALSLL
SRWNNLVQQLEAALQPVFYPDAIEEWLEENVLPSMQRLQGLLQDLGEAAAQQPPPTSPGW
DTGQNP
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacatgttccacaccatttaagatgagattagttcatttggaccttaaaggagcacct
ccaaaggtttcatatctctctgaggtgtttcccctgttccatgcactcggtgcgaatggt
ctcctcattgagtatgaagacatgtttccctatgagggccacctgaggctgctgagagcc
aagcatgcatacagcccctcggaagttacagagatcctgcgcctggccagactcagtggg
ctggaagttgtccccttggtgcagacgtttggacacatggagtttgtgctaaagcatgcg
gcatttgctcatctccgtgaagtggctcccttccccaacaccctgaaccctcatgaggct
gagtccctggccttggtacaagctatgatcgaccaaattctggagctacacagggatgtc
cggtggctccacatcggctgtgatgaggtctactacctgggtgagggggagacctcaaaa
cagtggctacagcaggaacagaacagccatgcgaaactgtgcctgaaccacatgcaggcg
gtagccagccatgtgctgacccagcatcctggcataacacccttggtgtgggatgacatg
ctacgggacatccctcaggaacagctaaaagcgtctggggtgcctcaactggtggagcct
gtgctctgggactatggagctgacctggatgtccacagcaaaaatttcctcatagggaag
taccaggagtgtggcttccagaggttgtgggctgccagtgccttcaagggagccacaggg
gccagtcaggctctgccccctgttgagcaccacatcagaaaccatgagctgtggctgcag
gtggcaggcagtgggccagtggatactctacaaggaatcatcctgactggctggcagagg
tacgaccacttctctgtgctgtgtgagctgctccctgtgggaatcccatccctggctgcc
tgtctacagtcacttgtacatggaggctttgctgaggatgttaggctgcgagtggaacgc
ttccttggggtttcaagcctggaaataacggataccgtaagtgagggagctggctccttt
cctggcagtgacatccatgccctcgtcacacaaattagtctccacctgcgcagctctgtg
gattcacttctggagaggaacaggtatgtcactggctggttcagcccctaccatcgcagg
cggaagcttgttcatcctgttatgatccagcacatacagccggaggcactcagccttcta
agcaggtggaacaacctcgtgcagcagctggaggcagccctgcagccggtcttctacccg
gacgccattgaagagtggctggaggagaatgtgctccccagtatgcagcgactgcagggt
ctgctgcaggacctgggtgaggcggccgcccaacagccaccacccaccagcccgggctgg
gacacaggccagaacccctga

DBGET integrated database retrieval system