KEGG   Rattus norvegicus (rat): 100359675Help
Entry
100359675         CDS       T01003                                 

Gene name
Alpp
Definition
alkaline phosphatase, placental
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100359675 (Alpp)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100359675 (Alpp)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100359675 (Alpp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9
AA seq 529 aa AA seqDB search
MWGACLLLLGLSLQMSLSLVPVEEENPAFWNRKAAEALEAAKKLQPIQTSANNLIILMGD
GMGVSTVTATRILKGQQQGHLGPETPLAMDRFPHMALSKTYNTDKQVPDSAGTGTAFLCG
VKTNMKVIGLSAAARFNQCNTTWGNEVVSVMHRAKKAGKSVGVVTTTSVQHASPAGTYAH
TVNRNWYSDAHMSTAALQEGCKDIAMQLISNTDIDVILGGGRKFMFPKGTPDQEYPTDPQ
QAGTRLDGRNLVQEWLAKHQGAQYVWNRTELIQASLNRSVTHLMGLFEPNDMKYNIDRDP
TQDPSLAEMTEVAVHMLSRNPKGFYLFVEGGRIDHGHHEAIAYRALTEAVMFDSAVDKAD
KLTSEKDTMIIVTADHSHVFSFGGYTQREASIFGLAPFKAGDGKSFTSILYGNGPGYKLN
NGIRADVTEEESSNPTYQQQAAVPLSSETHSGEDVAIFARGPQAHLVHGVQEQNYIAHVM
AFAGCLEPYTDCGLAPPAGRSSAVSPGYISTLLCLLAGTMLMLMVSAEP
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtggggagcctgcttgctgctgctgggcctcagcctacagatgtccctgagcctcgtc
ccagtggaggaggagaacccagcattctggaaccgaaaggcagccgaggccctggaggct
gccaagaagctgcagcccattcagacgtcagccaacaacctcatcatcctcatgggggac
gggatgggggtgtccacagtaacggctacccggatactaaagggacagcagcaaggccat
ctgggacctgagacgccactagccatggaccgcttcccacacatggctctgtccaaaaca
tacaacacagacaagcaggtcccggacagcgcaggcacaggcacggcctttctctgcggg
gtcaaaaccaatatgaaggtcattggcttgagtgcagctgcacgctttaatcagtgcaac
acaacgtggggtaatgaggtcgtctcggtaatgcaccgtgctaagaaagcagggaagtct
gtgggagtggtgaccaccacatcggtgcagcatgcctctccagccggcacctacgcacac
actgtgaaccgtaactggtactccgatgcacacatgtccactgctgcactacaggagggc
tgcaaggacatcgccatgcagctcatctccaacaccgacattgatgtgatcctcggtggt
ggccgcaagttcatgtttcctaagggaacaccagaccaggaatatccgactgaccctcag
caagctggaaccaggctggatggacgcaatctagttcaggagtggctggcaaaacaccag
ggtgcccagtatgtttggaaccgcacagagctcatccaggcctccctgaacagatctgtg
acacacctcatgggcctctttgaacctaatgacatgaaatacaacatcgaccgagaccct
actcaggatccctccctggccgagatgacagaggtggccgtgcacatgctcagcaggaac
cccaaaggcttctatctctttgtggaagggggccgcatcgaccatggtcaccatgaagct
atagcctatcgtgcactgactgaggctgtcatgttcgactcagctgttgacaaggcagat
aagctcaccagtgagaaggacacgatgatcattgtcaccgccgaccactctcatgttttc
tcttttggtggttacacacagagagaggcctccatttttgggctggctcccttcaaggct
ggggatggcaaatcctttacctcgattctatacggcaatggtcctggctacaagctcaat
aatggcatccgggctgatgtcaccgaggaagagagcagcaaccccacgtaccagcagcag
gcggctgtacccctgtcgtcagagacccacagtggggaggacgtggccatatttgcgcgt
ggccctcaggcgcacctggtgcacggagtgcaggaacagaactacatcgctcacgtcatg
gccttcgcaggctgcctggagccctacaccgactgcggccttgcgccccctgctggtcgg
agcagtgcagtgagtccaggctacatctccaccttgctgtgcctgttggcagggacaatg
ttgatgctgatggtgtcagctgaaccctga

DBGET integrated database retrieval system