KEGG   Rattus norvegicus (rat): 100359816Help
Entry
100359816         CDS       T01003                                 

Definition
rCG21620-like
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100359816
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100359816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
12
AA seq 1982 aa AA seqDB search
HHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMSSNRPVEI
VEDPRVVGIWSKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYG
EVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDTKGETRMR
FYELLVTGRYTPQTLPVGELDAISPIVSETLQLSDALKRLKDGNLSAGCGSGSSSVTPNS
GGTPFSQDTAYSSCRLDTPNSYGQGTPITPRLGTPFSQDSSYSSRQPTPSYLFSQDPAAT
FKARRHESKFTDAYNRRHEHHYVHNSAVAAAVAGATAPFRGSSDLSFGTVGGSGGGTPFK
TQSQDSTTYAHTPPPAQTATASGFKSAFSPYQTPAPPFPPPPEEPTATAAFGTRDSGEFR
RAPAPPPLPPSEPPAKEKPGTPPGPPPPDNNSMELGGRPTFGWSPEPCDSPGTPTLESSP
AGPEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTEIQMEGSPISSSSSQLSPLTHFGTN
SQPGFRGPSPPSSRPSSTGLEDISPTPLPDSDEDDDLGLGLGPRPPPEPGPPDPMGLLGQ
TAEVNLDLAGDRTPTSERMDEGQQSSGEDMEISDDEMPSAPITSADCPKPMVVTPGAGAV
AAPNVLAPNLPLPPXXXXXXXXPPPPPQPGFPMPPPLPPPPPPPPPPAHPAVTVPPPPLP
APPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQMQTQMLSRLMTGQGT
CPYPPFMAAAAAAASAGLQFVNLPPYRSPFSLSNSGPGRGQHWPPLPKFDPSVPPPGYIP
RQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWWDKKERMAKASLTPV
KSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAIRLPSFKVKRKEPPD
TASSGDQKRLRPSTSVDEEDEESERERDRDMADAPCELAKRDPKSVGVRRRPGRPLELDS
GGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASDKEEEERESTEEEEEEEEAEEEEEDE
ERPRSHISSPSSSSSSDKDDDDDDDSDDQIDSDIDDQGTALSVASEKDNVDSEEEEIERV
TTSKAPAVSSSSSSSSSSSESSGSSEFDSSSESSSSSSSSEDEDEMTVPGEDEEEEEEEE
EKETAMATATVVAMAEESMPPVGGQDFEQDRAEVPLGPRGPLRESLCTEEEVDIEAEDEV
PEMQAPVPEESPLPMGAQELSPEPPEEPSPNTQGDMLLSPELPARETEAQPPSLPEHGPE
SDLEVEPEPPPMLSLPLQPPLLPPRHPRPPSPPPEPETPEPPKPPVPLEPPPEDQPPRTP
GLCGSLAKSQSTETVPATPGGEPPLSGGSSGLSLSSPQVPGSPFSYPSPSPGLSSGGLPR
TPGRDFTFTPTFPEPSGPLLLPVCPLPTGRRDERAGPLASPVLLETGLPLPLPLPLPLPL
ALPVPVLRAQPRPPPQLPPLLPATLAPCPTPIKRKPGRPRRSPPSMLSLDGPLVRPPPGP
ALGRDLLLLPGQPQAPIFPSAHDPRAVTLDFRNTGIPAPPPPLPPQPPPPPPPPPVEPTK
LPFKELDNQWPSEAIPPGPRRDEVTEEYMDLAKVRGPWRRPPKKRHEDLVAQSASPEPSP
PQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPS
TSLSSAKKKKREDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPMDTQGMSIP
AQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAM
EPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFI
NHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGT
LN
NT seq 5949 nt NT seq  +upstreamnt  +downstreamnt
caccaccaccaccagcagcccccgccgcagcccggcccttcgggcgagaggaggaaccac
cattggagaagttacaagttgatgattgacccggctctgaaaaaggggcaccataaactg
taccgctacgatgggcagcatttcagcctggcgatgtccagcaaccgcccggtggaaatc
gtggaagatccccgggtggtcggcatctggagcaaaaacaaggagctggagctgtcggtg
cccaaattcaagatcgatgagttctacgtgggccctgtgcctcccaagcaggtgacattt
gccaagctgaatgacaacatccgcgaaaacttcctaagggacatgtgcaaaaagtatggg
gaagttgaggaggtggagattttgtataacccgaagaccaagaaacacctgggcatcgcc
aaggtagtctttgccacggtcaggggcgccaaggaggcagtccaacacttgcatagcact
tctgtcatgggtaacatcatccacgtggagctggacaccaaaggggaaactcgcatgcgc
ttctatgaactgctggtcaccggccggtacacccctcagaccctcccagtgggtgagctg
gatgctatttctccaattgtgagcgagaccctgcagctctcggacgctctgaagcggctc
aaagatggtaacctgtccgcaggctgtggctctggctcctcctcggtcacccccaatagt
ggcgggacccccttctcccaggatacagcctactccagctgccgtctggacacacccaac
tcctacggacaaggcaccccgatcacgccccgcctgggcacccctttctcccaagattcc
agctattccagtcgtcagcccacaccctcctacctcttcagccaggaccccgcagcaact
ttcaaggccaggcggcacgagagcaagttcacagatgcctataaccgccgtcatgaacac
cattatgtccacaattccgcggtggcagctgcggtggcaggagccacggctcctttccga
ggctcctcagacctctcttttgggacagttggcggcagtggcggcggcactcccttcaag
actcaatcccaggattccaccacatatgcccatactccacctcctgcccaaacagccact
gcttccggattcaaatcagccttttctccataccagactccagcacccccattcccgcca
ccccccgaggagcccactgccacagcagccttcgggacccgcgacagtggggagttccgg
agggcacccgcgcccccacccctgccgccctctgagcctccagccaaggagaagccgggc
acacctcccggtcccccaccccctgacaacaacagcatggagctgggtggtaggcctacc
tttggctggagtcctgagccctgtgacagccctggcactcctactctggagtcttctcca
gcgggaccagagaagccccatgacagcctggactcccgcattgagatgctgttgaaggaa
caacgcaccaagctgcccttcctgcgggagcaggactcagacaccgagatccagatggaa
ggcagccccatctcctcctcctcctcccagctctccccactcacccactttggcactaac
tcccagcctggcttccgtggcccctcgccaccctcctcacgcccctctagcacgggccta
gaggacatcagccctacaccactgcctgattccgacgaggatgatgacctgggcctgggc
ctcgggcctcggcccccacctgagccaggccccccagaccctatgggtcttctaggccag
acagctgaggtgaatttggacctggcaggagacaggaccccgacctcagagcggatggat
gagggccagcagtcctctggagaggacatggaaatctcagacgatgagatgccctcagcc
cccatcaccagcgctgactgccccaagcccatggtggtgaccccaggggcaggggctgtg
gcagcccctaatgtgcttgctccaaacctgcccctgcccccannnnnnnnnnnnnnnnnn
nnnnctcccccacccccaccgcaacctggcttccccatgcccccacctttgccgccgcca
ccaccaccaccaccaccaccagcccatcctgcagtgacagtccccccgccacccttgcca
gcgcccccgggtgtcccacccccacccatccttccaccactgccgcccttcccgccagga
ctgtttcctgtgatgcaggtggacatgagccatgtgctgggtgggcagtggggcggcatg
cccatgtccttccagatgcaaacacagatgttaagccggctcatgacaggccagggtact
tgcccctacccacccttcatggccgctgccgccgctgccgcttctgctgggctacagttt
gtcaacttgcccccctaccggagcccgttctccctgagcaacagtggcccaggacgtgga
cagcactggccgcccctgcccaagtttgacccctctgtgccaccaccaggctacataccg
cgtcaggaggatccgcacaaggccacagtggatggggtcctgctagtagtgctcaaggaa
ctgaaggccattatgaagcgggatctcaaccgcaagatggtggaggtggtggccttccgg
gcctttgacgaatggtgggacaaaaaggagcggatggccaaggcctcactgacccccgtg
aagtctggtgagcacaaggatgaggacaggccaaagcccaaagaccgaatcgcctcctgc
ctgctggaatcatggggcaagggcgagggcctgggttacgagggcctaggcctgggcatt
ggactacggggcgccattcgcctgccctccttcaaggtcaagaggaaggagccaccggac
acagcctcttctggcgaccagaagcggctgcggccttcaacctctgtggatgaggaagat
gaagagtcggaacgggagcgtgaccgggacatggctgatgccccgtgcgaactcgccaag
cgggaccccaaaagtgtgggtgtgcgacgccggccaggacggcccctggagctggacagc
ggtggggaggaggacgagaaggagtccttgtccgtgtcctcatcttcctcagcatcctca
tcctctggatcttccacaacctcaccctcatcctccgcctcggacaaggaagaggaggaa
cgagaaagcactgaggaggaggaagaggaagaggaagcagaggaagaggaggaggatgaa
gagcgccccaggagccacatatcctccccctcatcctcatccagctctgataaggatgat
gatgatgatgatgacagtgatgaccagattgattctgacatcgacgatcagggtacagcc
ctgtcggtggccagtgagaaggacaatgttgattctgaggaagaggagatagagagagtc
accacctccaaggccccggctgtgtcatcgtcgtcatcgtcgtcgtcgtcctccagtgaa
agttctggatcttctgaattcgattccagttctgagtcctcatcctcatcttcatcctcg
gaggatgaagacgagatgactgtacctggggaagacgaggaagaggaggaggaggaggag
gagaaagagaccgcaatggctacagcgacggtagtggcgatggccgaggagagcatgcct
ccagtgggcggccaggactttgagcaggatagggcagaagtgcctctgggcccaagaggc
cccctgagggagtccttgtgcacagaagaggaagtggacattgaggccgaggacgaagtc
cccgagatgcaggctcctgtgccggaagagtctccattgcccatgggtgctcaggaactg
agccccgagcccccagaagagccaagcccaaacacacaaggggacatgttgctctctcca
gaactccctgccagggagacagaagctcaacccccatcactccctgaacatggtccagag
tcagacctggaagtggagcccgagccccctccgatgctctccttacccttgcagccacca
ttgctaccccctcgacatccccggccacccagcccaccacctgagcccgagaccccagag
ccccccaaacctcctgtccccctggagcctcctcccgaagaccagcctccacgtaccccg
ggcctctgtggcagtctggccaagtcacagagcacggagacagtgccggccaccccgggc
ggggagcctccactgtcagggggcagcagtggcctgtcactgagctccccgcaggtgcct
ggcagcccgttctcatacccttccccgtcccctggcttgagcagtgggggccttccacgg
acacctggtcgggacttcaccttcacacctaccttccctgagcccagtgggcccttgctt
ctgcctgtctgccccctccccactggtcgacgagatgagcgcgctggccccctggcctcc
ccagtgctcctggaaactggcctgcccctcccccttcccctgcctctgcccttacctctg
gcattgcctgtccctgtcctgagggcccagcctcggccgcctccccagctgcctccctta
ctgcctgctaccctagctccctgcccaacccccatcaagaggaagccaggccggccccgg
cgatccccaccatctatgctgtccttggatggacctttggtccggccaccaccagggcct
gcccttgggagggaccttctgctcctgccaggccaaccacaggcccccattttccccagt
gcacatgatccccgggccgtgaccttggacttccggaacacggggatcccagccccccca
ccgcccctcccaccccagcctcctccacccccgccaccaccacctgttgagcccaccaag
ctgcccttcaaggagctggacaaccagtggccctctgaagctattcccccaggacctcgc
cgagatgaggtcactgaagagtacatggacctggccaaggtgcggggaccatggcgacgg
ccacctaagaagcgccacgaagacctggtggcccaatcagcctcacccgaaccctcacca
ccccagcctctcttccggccccgctcagagtttgaggagatgaccatcctgtatgacatc
tggaatggtggcattgatgaggaggacatccgcttcctatgcgtcacctacgagcgcctg
ttgcagcaggacaatggcatggactggctgaatgacacactctgggtctaccatccctcc
accagcctttcctcagccaagaaaaagaaacgggaggacggtatccgtgagcacgtgaca
ggctgcgcccgaagcgagggcttctacaccatcgacaagaaagacaagctgagatacctc
aatagcagccgtgccagcacagatgagccccccatggatacccagggtatgagcatccca
gcacagccccatgcctctacccgggcaggctcagagcggcggtctgagcagcggcgcctc
ctgtcctccttcaccggcagctgtgacagtgacctgctcaagttcaaccagctcaagttt
cggaagaaaaagctcaagttctgtaagagccacattcacgactggggcctgtttgccatg
gagcccatcgctgccgatgagatggtcattgagtacgtgggtcagaacatccgccaggtg
attgcagacatgagggagaaacggtacgaggacgaaggcatcggtagcagctacatgttc
agggtagaccacgacaccatcatcgacgccaccaagtgcggcaactttgcgcggttcatt
aatcacagctgcaatcccaactgctatgccaaggtgatcacggtggagtcccagaagaaa
attgtcatctactccaagcagcacatcaatgtcaacgaggagatcacatatgactataag
ttccccattgaggacgtcaagataccctgcctctgtggctccgagaactgccgggggacc
ctcaactag

DBGET integrated database retrieval system