KEGG   Rattus norvegicus (rat): 100359816Help
Entry
100359816         CDS       T01003                                 

Definition
rCG21620-like
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:rno00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
12
AA seq 2263 aa AA seqDB search
MAPSAAPSPFLQETQYTATPPGGSSDRPWKLKGQQGLASVTEQVCRKLHGGNDEKRIVLA
PNGRQGQPERGLVPAWALGVRGCNGDRGPQPASSGSPYPASASPAAATVRAAPGEGAGGS
ESGIMVRDAPPPRGLRSPETRHQDRGRRASQALRARYCLPAPSDNRGKAGWRKEGGKPAA
ISHSSSERPGGFSFGSNPTQPSARLKNLKIKLVFGREERARPGGQAAPGCRRERCCVMVP
TWTPAFCPFSLWKSRRAPEPRRAGFRVQKHPQSNGNETLDWHHHHQQPPPQPGPSGERRN
HHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMSSNRPVEIVEDPRVVGIWSKNKELELS
VPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGI
AKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLVTGRYTPQTLPVGE
LDAISPIVSETLQLSDALKRLKDGNLSAGCGSGSSSVTPNSGGTPFSQDTAYSSCRLDTP
NSYGQGTPITPRLGTPFSQDSSYSSRQPTPSYLFSQDPAATFKARRHESKFTDAYNRRHE
HHYVHNSAVAAAVAGATAPFRGSSDLSFGTVGGSGGGTPFKTQSQDSTTYAHTPPPAQTA
TASGFKSAFSPYQTPAPPFPPPPEEPTATAAFGTRDSGEFRRAPAPPPLPPSEPPAKEKP
GTPPGPPPPDNNSMELGGRPTFGWSPEPCDSPGTPTLESSPAGPEKPHDSLDSRIEMLLK
EQRTKLPFLREQDSDTEIQMEGSPISSSSSQLSPLTHFGTNSQPGFRGPSPPSSRPSSTG
LEDISPTPLPDSDEDDDLGLGLGPRPPPEPGPPDPMGLLGQTAEVNLDLAGDRTPTSERM
DEGQQSSGEDMEISDDEMPSAPITSADCPKPMVVTPGAGAVAAPNVLAPNLPLPPXXXXX
XXXPPPPPQPGFPMPPPLPPPPPPPPPPAHPAVTVPPPPLPAPPGVPPPPILPPLPPFPP
GLFPVMQVDMSHVLGGQWGGMPMSFQMQTQMLSRLMTGQGTCPYPPFMAAAAAAASAGLQ
FVNLPPYRSPFSLSNSGPGRGQHWPPLPKFDPSVPPPGYIPRQEDPHKATVDGVLLVVLK
ELKAIMKRDLNRKMVEVVAFRAFDEWWDKKERMAKASLTPVKSGEHKDEDRPKPKDRIAS
CLLESWGKGEGLGYEGLGLGIGLRGAIRLPSFKVKRKEPPDTASSGDQKRLRPSTSVDEE
DEESERERDRDMADAPCELAKRDPKSVGVRRRPGRPLELDSGGEEDEKESLSVSSSSSAS
SSSGSSTTSPSSSASDKEEEERESTEEEEEEEEAEEEEEDEERPRSHISSPSSSSSSDKD
DDDDDDSDDQIDSDIDDQGTALSVASEKDNVDSEEEEIERVTTSKAPAVSSSSSSSSSSS
ESSGSSEFDSSSESSSSSSSSEDEDEMTVPGEDEEEEEEEEEKETAMATATVVAMAEESM
PPVGGQDFEQDRAEVPLGPRGPLRESLCTEEEVDIEAEDEVPEMQAPVPEESPLPMGAQE
LSPEPPEEPSPNTQGDMLLSPELPARETEAQPPSLPEHGPESDLEVEPEPPPMLSLPLQP
PLLPPRHPRPPSPPPEPETPEPPKPPVPLEPPPEDQPPRTPGLCGSLAKSQSTETVPATP
GGEPPLSGGSSGLSLSSPQVPGSPFSYPSPSPGLSSGGLPRTPGRDFTFTPTFPEPSGPL
LLPVCPLPTGRRDERAGPLASPVLLETGLPLPLPLPLPLPLALPVPVLRAQPRPPPQLPP
LLPATLAPCPTPIKRKPGRPRRSPPSMLSLDGPLVRPPPGPALGRDLLLLPGQPQAPIFP
SAHDPRAVTLDFRNTGIPAPPPPLPPQPPPPPPPPPVEPTKLPFKELDNQWPSEAIPPGP
RRDEVTEEYMDLAKVRGPWRRPPKKRHEDLVAQSASPEPSPPQPLFRPRSEFEEMTILYD
IWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKREDGIREHV
TGCARSEGFYTIDKKDKLRYLNSSRASTDEPPMDTQGMSIPAQPHASTRAGSERRSEQRR
LLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQ
VIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQK
KIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 6792 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctctgccgccccctccccattcctccaggagacgcaatacacggctacacca
ccagggggcagcagcgaccgcccgtggaaactcaaaggacaacagggactggcctcggtg
acagagcaagtctgcaggaagctgcatggaggaaatgacgagaagcgaatagttctggct
ccgaacggcaggcaagggcagccagagcgaggcctcgtgcccgcgtgggccttgggagtc
cggggctgcaacggagatcggggtcctcaacccgcctccagcggctcgccctacccggcc
tcggcttcccccgcggccgccactgtccgagccgcgcccggggagggggctggggggagc
gagtcgggaattatggtgcgcgacgccccccccccccgaggcctaaggtcccccgagacc
cgtcaccaggatcgcgggcgccgtgcctcgcaggctcttagggcccggtactgcctcccg
gctcccagcgacaaccgggggaaagcaggatggcggaaggaaggaggaaagccggccgcc
attagccatagcagtagtgaacggccgggcggcttcagctttggctccaacccgacccag
ccctcggctcggctcaaaaacctgaaaataaaactcgtgtttgggagggaggagcgagcg
cggcccggaggacaagcagcgccgggctgcaggcgggagagatgctgcgtcatggtgcca
acatggacgccggccttttgtcctttttctctttggaagagcagacgagccccggagccc
cgaagagctggcttccgggtgcagaaacacccacaatcgaatgggaacgagaccttagat
tggcaccaccaccaccagcagcccccgccgcagcccggcccttcgggcgagaggaggaac
caccattggagaagttacaagttgatgattgacccggctctgaaaaaggggcaccataaa
ctgtaccgctacgatgggcagcatttcagcctggcgatgtccagcaaccgcccggtggaa
atcgtggaagatccccgggtggtcggcatctggagcaaaaacaaggagctggagctgtcg
gtgcccaaattcaagatcgatgagttctacgtgggccctgtgcctcccaagcaggtgaca
tttgccaagctgaatgacaacatccgcgaaaacttcctaagggacatgtgcaaaaagtat
ggggaagttgaggaggtggagattttgtataacccgaagaccaagaaacacctgggcatc
gccaaggtagtctttgccacggtcaggggcgccaaggaggcagtccaacacttgcatagc
acttctgtcatgggtaacatcatccacgtggagctggacaccaaaggggaaactcgcatg
cgcttctatgaactgctggtcaccggccggtacacccctcagaccctcccagtgggtgag
ctggatgctatttctccaattgtgagcgagaccctgcagctctcggacgctctgaagcgg
ctcaaagatggtaacctgtccgcaggctgtggctctggctcctcctcggtcacccccaat
agtggcgggacccccttctcccaggatacagcctactccagctgccgtctggacacaccc
aactcctacggacaaggcaccccgatcacgccccgcctgggcacccctttctcccaagat
tccagctattccagtcgtcagcccacaccctcctacctcttcagccaggaccccgcagca
actttcaaggccaggcggcacgagagcaagttcacagatgcctataaccgccgtcatgaa
caccattatgtccacaattccgcggtggcagctgcggtggcaggagccacggctcctttc
cgaggctcctcagacctctcttttgggacagttggcggcagtggcggcggcactcccttc
aagactcaatcccaggattccaccacatatgcccatactccacctcctgcccaaacagcc
actgcttccggattcaaatcagccttttctccataccagactccagcacccccattcccg
ccaccccccgaggagcccactgccacagcagccttcgggacccgcgacagtggggagttc
cggagggcacccgcgcccccacccctgccgccctctgagcctccagccaaggagaagccg
ggcacacctcccggtcccccaccccctgacaacaacagcatggagctgggtggtaggcct
acctttggctggagtcctgagccctgtgacagccctggcactcctactctggagtcttct
ccagcgggaccagagaagccccatgacagcctggactcccgcattgagatgctgttgaag
gaacaacgcaccaagctgcccttcctgcgggagcaggactcagacaccgagatccagatg
gaaggcagccccatctcctcctcctcctcccagctctccccactcacccactttggcact
aactcccagcctggcttccgtggcccctcgccaccctcctcacgcccctctagcacgggc
ctagaggacatcagccctacaccactgcctgattccgacgaggatgatgacctgggcctg
ggcctcgggcctcggcccccacctgagccaggccccccagaccctatgggtcttctaggc
cagacagctgaggtgaatttggacctggcaggagacaggaccccgacctcagagcggatg
gatgagggccagcagtcctctggagaggacatggaaatctcagacgatgagatgccctca
gcccccatcaccagcgctgactgccccaagcccatggtggtgaccccaggggcaggggct
gtggcagcccctaatgtgcttgctccaaacctgcccctgcccccannnnnnnnnnnnnnn
nnnnnnnctcccccacccccaccgcaacctggcttccccatgcccccacctttgccgccg
ccaccaccaccaccaccaccaccagcccatcctgcagtgacagtccccccgccacccttg
ccagcgcccccgggtgtcccacccccacccatccttccaccactgccgcccttcccgcca
ggactgtttcctgtgatgcaggtggacatgagccatgtgctgggtgggcagtggggcggc
atgcccatgtccttccagatgcaaacacagatgttaagccggctcatgacaggccagggt
acttgcccctacccacccttcatggccgctgccgccgctgccgcttctgctgggctacag
tttgtcaacttgcccccctaccggagcccgttctccctgagcaacagtggcccaggacgt
ggacagcactggccgcccctgcccaagtttgacccctctgtgccaccaccaggctacata
ccgcgtcaggaggatccgcacaaggccacagtggatggggtcctgctagtagtgctcaag
gaactgaaggccattatgaagcgggatctcaaccgcaagatggtggaggtggtggccttc
cgggcctttgacgaatggtgggacaaaaaggagcggatggccaaggcctcactgaccccc
gtgaagtctggtgagcacaaggatgaggacaggccaaagcccaaagaccgaatcgcctcc
tgcctgctggaatcatggggcaagggcgagggcctgggttacgagggcctaggcctgggc
attggactacggggcgccattcgcctgccctccttcaaggtcaagaggaaggagccaccg
gacacagcctcttctggcgaccagaagcggctgcggccttcaacctctgtggatgaggaa
gatgaagagtcggaacgggagcgtgaccgggacatggctgatgccccgtgcgaactcgcc
aagcgggaccccaaaagtgtgggtgtgcgacgccggccaggacggcccctggagctggac
agcggtggggaggaggacgagaaggagtccttgtccgtgtcctcatcttcctcagcatcc
tcatcctctggatcttccacaacctcaccctcatcctccgcctcggacaaggaagaggag
gaacgagaaagcactgaggaggaggaagaggaagaggaagcagaggaagaggaggaggat
gaagagcgccccaggagccacatatcctccccctcatcctcatccagctctgataaggat
gatgatgatgatgatgacagtgatgaccagattgattctgacatcgacgatcagggtaca
gccctgtcggtggccagtgagaaggacaatgttgattctgaggaagaggagatagagaga
gtcaccacctccaaggccccggctgtgtcatcgtcgtcatcgtcgtcgtcgtcctccagt
gaaagttctggatcttctgaattcgattccagttctgagtcctcatcctcatcttcatcc
tcggaggatgaagacgagatgactgtacctggggaagacgaggaagaggaggaggaggag
gaggagaaagagaccgcaatggctacagcgacggtagtggcgatggccgaggagagcatg
cctccagtgggcggccaggactttgagcaggatagggcagaagtgcctctgggcccaaga
ggccccctgagggagtccttgtgcacagaagaggaagtggacattgaggccgaggacgaa
gtccccgagatgcaggctcctgtgccggaagagtctccattgcccatgggtgctcaggaa
ctgagccccgagcccccagaagagccaagcccaaacacacaaggggacatgttgctctct
ccagaactccctgccagggagacagaagctcaacccccatcactccctgaacatggtcca
gagtcagacctggaagtggagcccgagccccctccgatgctctccttacccttgcagcca
ccattgctaccccctcgacatccccggccacccagcccaccacctgagcccgagacccca
gagccccccaaacctcctgtccccctggagcctcctcccgaagaccagcctccacgtacc
ccgggcctctgtggcagtctggccaagtcacagagcacggagacagtgccggccaccccg
ggcggggagcctccactgtcagggggcagcagtggcctgtcactgagctccccgcaggtg
cctggcagcccgttctcatacccttccccgtcccctggcttgagcagtgggggccttcca
cggacacctggtcgggacttcaccttcacacctaccttccctgagcccagtgggcccttg
cttctgcctgtctgccccctccccactggtcgacgagatgagcgcgctggccccctggcc
tccccagtgctcctggaaactggcctgcccctcccccttcccctgcctctgcccttacct
ctggcattgcctgtccctgtcctgagggcccagcctcggccgcctccccagctgcctccc
ttactgcctgctaccctagctccctgcccaacccccatcaagaggaagccaggccggccc
cggcgatccccaccatctatgctgtccttggatggacctttggtccggccaccaccaggg
cctgcccttgggagggaccttctgctcctgccaggccaaccacaggcccccattttcccc
agtgcacatgatccccgggccgtgaccttggacttccggaacacggggatcccagccccc
ccaccgcccctcccaccccagcctcctccacccccgccaccaccacctgttgagcccacc
aagctgcccttcaaggagctggacaaccagtggccctctgaagctattcccccaggacct
cgccgagatgaggtcactgaagagtacatggacctggccaaggtgcggggaccatggcga
cggccacctaagaagcgccacgaagacctggtggcccaatcagcctcacccgaaccctca
ccaccccagcctctcttccggccccgctcagagtttgaggagatgaccatcctgtatgac
atctggaatggtggcattgatgaggaggacatccgcttcctatgcgtcacctacgagcgc
ctgttgcagcaggacaatggcatggactggctgaatgacacactctgggtctaccatccc
tccaccagcctttcctcagccaagaaaaagaaacgggaggacggtatccgtgagcacgtg
acaggctgcgcccgaagcgagggcttctacaccatcgacaagaaagacaagctgagatac
ctcaatagcagccgtgccagcacagatgagccccccatggatacccagggtatgagcatc
ccagcacagccccatgcctctacccgggcaggctcagagcggcggtctgagcagcggcgc
ctcctgtcctccttcaccggcagctgtgacagtgacctgctcaagttcaaccagctcaag
tttcggaagaaaaagctcaagttctgtaagagccacattcacgactggggcctgtttgcc
atggagcccatcgctgccgatgagatggtcattgagtacgtgggtcagaacatccgccag
gtgattgcagacatgagggagaaacggtacgaggacgaaggcatcggtagcagctacatg
ttcagggtagaccacgacaccatcatcgacgccaccaagtgcggcaactttgcgcggttc
attaatcacagctgcaatcccaactgctatgccaaggtgatcacggtggagtcccagaag
aaaattgtcatctactccaagcagcacatcaatgtcaacgaggagatcacatatgactat
aagttccccattgaggacgtcaagataccctgcctctgtggctccgagaactgccggggg
accctcaactag

DBGET integrated database retrieval system