KEGG   Rattus norvegicus (rat): 100361307Help
Entry
100361307         CDS       T01003                                 

Definition
hypothetical LOC100361307
Orthology
K03259  
translation initiation factor 4E
Organism
rno  Rattus norvegicus (rat)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100361307
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100361307
   04151 PI3K-Akt signaling pathway
    100361307
   04150 mTOR signaling pathway
    100361307
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100361307
Translation factors [BR:rno03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100361307
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
14
AA seq 190 aa AA seqDB search
RRRDTLKDGDNGDHDQNKESGMQKGGEKCSVHRAMSRTSAAFTSVEQFWKFYSHMVRPGV
LTDHSDFHLFKERIKPMWEDDANKDGARXIVRLPKGLASHCPENLILAILREPXFSYGEE
SCRAVVSVCFQEDIISIRNNTXQAATVRIQDNPQHVFTLPPNTIMTHTDSIKTPGSLDPQ
RRSFFSFQNL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
aggcggcgagacaccttaaaagacggtgacaatggagaccatgatcagaataaagaaagc
ggcatgcagaaaggtggtgagaagtgttcagttcacagagctatgagcagaacatcagct
gccttcacctctgtggagcagttctggaagttttacagccacatggtacgtcctggggtc
ctgacagatcacagtgactttcatctcttcaaagaaaggattaaacccatgtgggaggat
gatgcaaacaaagatggggccaggnggatcgttcgacttccgaagggcttagcttcccat
tgcccggagaatctcatcctggccatactaagggagccataattctcgtatggggaggag
agctgcagggccgtggtctctgtgtgctttcaggaggacattatttctataaggaataat
accnnacaagcagccacagtgcgaatccaggataatcctcagcacgtgtttaccctacct
cccaacaccattatgacccacactgacagcatcaaaacgccaggcagcctggacccccaa
aggcgctcttttttttcttttcaaaatctctga

DBGET integrated database retrieval system