KEGG   Rattus norvegicus (rat): 100361658Help
Entry
100361658         CDS       T01003                                 

Gene name
Usp37
Definition
(RefSeq) ubiquitin specific peptidase 37
  KO
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100361658 (Usp37)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100361658 (Usp37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q33
AA seq 979 aa AA seqDB search
MSPLKIYGPIRIRSMQTGITKWKEGSFEIVDKDSKVSLVVHYNTGGIPRVFQLSHNIKNV
VLRPSGTKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLHAAMKSSQGSGSF
GTILGSRTSQKETNRQLSYSDNQASSKRGSLETKDEIPFRKVLGNPGRGPIKTVTGSGMA
VTRTIPSLTLTSTPLRTGLLENRTEKRKRMLSGSELTEDYPKENDSSSNNKAMTDPSRKY
LSSSREKQLSLKQAEENRTPGLLPLQSSSFYGSRTGSKDYSSGGTNLDRCNISNQTPSAK
RSLGFLPQPTPLSVKKLRCNQDYTGWNKPRAPLSSHQQQLQGFSNLGNTCYMNAILQSLF
SLQSFANDLLKQSIPWKKIPLNALIRRFANLLIKKDISNSETKKELLKKVKNAISATAER
FSGYVQNDAHEFLSQCLDQLKEDMEKLNKTWKTEPVLGEENSPDTSATKVFTCPVITNLE
FEVQHSIICKACGETIPKREQFNDLSIDLPRRKKPLPPRSIQDSLDLFFRAEELEYSCEK
CGGKCALVRHKFIRLPRVLILHLKRYSFNVALSLNNKIGQQVIIPRYLTLSSHCTENTKP
PFTLGWSAHMAISRPLRACQMVNSCITSPSAPSKKFTFKSKSSLTSCLDSDSEDELKRSV
ALSQRLCDLPGNEQYQEDVEKDLKLCRLDPGKSELENSGFDRMSEEEVLAAVLEISRREA
SPVLSPEDDDKPTSSPDTGFAEDDIPEMPENPDAMEIEKPKAITEPGPASFTEITKDCDE
NKENKTPEGSQGEVDWLQQYDIEREREEQELQQALAQSLQEQEAWEQKEDDDLKRATELS
LQEFNNSFLDSLGSDEDSGNEDVFDMEYTEAEAEELKRNAETGNLPHSYRLISVVSHIGS
TSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEAAVQSDRDRSGYIFFYMHKEIFDELLET
EKTSQALSMEVGRAARQAS
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctctgaagatatatggtcctatcagaattcgaagtatgcagactgggattaca
aagtggaaagaaggatcctttgaaattgtggacaaagacagtaaagtcagcctggtagtt
cactacaacactggaggaattccaagagtgtttcagctaagtcataacattaaaaatgtg
gtactacgacccagtggaacaaaacaaagtcgcctaatgttgactctacaagataacagc
ttcttgtctattgacaaagtaccaagtaaggatgcagaggaaatgaggttgttcctagat
gcagtccaccaaaacagacttcatgcagctatgaaatcttctcaaggttctggtagtttt
ggaactattctgggcagcaggacctctcagaaggaaactaacagacagctttcttactca
gacaatcaggcctcttcaaaaagaggaagtttagaaactaaagatgaaattccatttcga
aaagttcttggcaatcctggtagaggaccgattaagactgtaaccggaagtggaatggct
gttacccggactattccttctttgacgctgacatcaacaccccttagaacaggattatta
gaaaaccgcactgaaaagaggaaaagaatgttgtctggttcagagctgaccgaagattat
cctaaggaaaatgattcatcatcgaacaacaaagctatgacagacccttcaagaaaatac
ttaagcagcagtagagaaaagcagctgagtttgaaacaagcagaagaaaatcgaacaccg
gggcttttacctttgcagtcatcctcattttatgggagcagaactggatcaaaggactac
tcttctggtggcactaacctggacaggtgtaatatttcaaaccagactccttctgccaaa
agaagcttggggttccttcctcagccaactcccctatctgttaaaaaactgaggtgtaac
caggattacacaggctggaacaaacctagagcgcccctttcctctcaccaacagcagctg
cagggattctccaatttgggaaatacatgctatatgaatgctatcttacaatctctgttt
tcactccagtcatttgcaaatgatttacttaaacaaagtatcccatggaagaaaattcca
ctcaatgcacttatcagacgctttgcaaacctgcttattaaaaaagatatttctaattca
gagaccaaaaaagaactacttaagaaggttaaaaatgctatttcagctactgcagagaga
ttctctggctatgtccaaaatgatgctcatgaatttttaagtcagtgcttagatcagctg
aaggaagatatggaaaaactgaataaaacttggaagacagaacctgtccttggagaagaa
aattcaccagatacatcagctaccaaagtgttcacttgccctgttattacaaacttggaa
tttgaggttcagcactccattatctgtaaagcatgtggagaaactattcccaaaagagaa
cagtttaatgatctctccattgaccttcctcggaggaaaaaaccactccctcctcgttca
attcaagattctcttgatcttttctttagggcagaagaacttgaatactcctgtgaaaag
tgtggtggaaaatgtgctcttgtcaggcacaaatttatcaggctgcccagggtcctcatt
cttcatttgaaacgatacagcttcaatgtggctctctcgcttaacaacaagataggacaa
caagtcatcattccaagatacctgaccctgtcatcacactgcactgaaaatacaaaacca
ccttttactcttgggtggagtgcacatatggcaatttctagaccattgagagcctgtcaa
atggtgaattcctgcatcaccagtccttctgcaccttcaaagaaatttaccttcaaatcc
aagagctccttgacatcatgccttgattctgacagtgaggatgaacttaaacgctctgtg
gccctcagtcagagactttgtgatttgccaggcaatgaacagtaccaggaagatgtggaa
aaagatttgaaattgtgcagattagatcctgggaagtccgaattggagaactcaggattt
gacagaatgagtgaggaagaggtgctggcagctgtgttagagataagcaggagagaagcc
tcgccggtactcagccctgaagatgatgataagccaaccagcagtccggacactgggttt
gcagaagatgatattccagagatgcctgaaaatccagacgctatggaaattgagaaaccc
aaagcaatcactgagccaggtcctgctagttttactgagataacaaaagactgtgatgag
aataaagaaaacaaaactccagaaggttctcagggagaggttgattggctccagcagtat
gacatagagcgggaaagagaggagcaggagctgcaacaagccctggcccagagccttcaa
gaacaagaggcttgggaacaaaaagaagatgatgacctcaaaagggctacagagttaagt
cttcaagagtttaacaactcttttctggattccctgggctcagatgaggactctggaaac
gaggatgtttttgatatggagtacacagaagctgaagccgaggaactgaaaagaaatgct
gagacaggaaatcttcctcactcctatcggctcatcagtgttgtcagtcacattgggagc
acctcttcttcaggtcattacattagtgatgtgtatgacattaagaaacaggcatggttc
acttacaatgacttggaggtctctaaaatccaagaggctgccgtgcagagtgatcgagat
cgcagcggctatattttcttctatatgcacaaggaaatctttgatgagttgctggagaca
gaaaaaacctctcaggcgcttagcatggaggtggggagagctgctcgtcaggcctcgtga

DBGET integrated database retrieval system