KEGG   Rattus norvegicus (rat): 100361710Help
Entry
100361710         CDS       T01003                                 

Gene name
Setdb2
Definition
(RefSeq) SET domain, bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100361710 (Setdb2)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100361710 (Setdb2)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100361710 (Setdb2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100361710 (Setdb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Position
15p12
AA seq 1008 aa AA seqDB search
MEEKIGDAKTFWMELQDDGKVDFMFEKAQDVLHSLKQKIKDGSATNGDYVQAMVLVNEAT
LSNSQTLEKDHTPVTQNEQKNKSNVFPSTSCENPSPEDCIILSTGRKGFLPVNNKTEGSG
EKEPPLHASFHHHVCSSACLREAPLSLKGENPLQLPLRCHFQRRHAKTNSPSAALHVNYR
TPCGRSLRNMEEVFHYLLETECNFLFTDNFSFNTYVQLTRNHPKQNEVVSDVDISNGVES
VSISFCNEVDNSKLPQFKYRTTVWPRAYHLNVSSMFSDSCDCSEGCIDIKKCACLQLTAK
NAKACPLSPDGECTGYKYKRLQRLIPSGIYECNLFCKCNRQMCQNRVIQHGPRVRLQVFK
SEKKGWGVRCLDDIDKGTFVCIYSGRLLSRATPEKTNIGESESEQQHTVKNSFSKKRKIE
VVCSDRQTHCESPKTEGCPPKFSSDLEEPVVEMNNRNISRTQRHSVIRRPKSKTDVFHYN
EKNMGFVCSYSAAPEEKNGFKPAQEHLDSKARRAHEDLSSSQVGYSEDKQLTESDVIDTT
TSREDTSPAYGCKHAAILNSKNTKKVLEVPVKTSQEEEPAASQSQQVSCGEELASERTKI
PSASLVQLSKESLFLLDASKEGNVGRFLNHSCYPNLWVQNVFVETHDRNFPLAAFFTNRY
VKARTELTWDYGYEAGTMPEKEILCQCFCQVTEKMEKRTCVLCPEGHDWSVIYFSPSANI
AAHENCLLYSSGLVECEAHDPFNIAKNFDVSSVLEKIWNGSTSKCSFCNNEGAIMGCDET
SCAKNYHLLCAKEDRAILQVGVKRTYKIFCPEHPPQQEETTERANGLSIKKRRGRKKRRS
LGPPAQPKTMKCRRSRRHVTGEALGQRDAAVKAPFLKKCLEAGLLTELFEQIQQKMISIH
GRFMDETASESDYEGIETLVFGCGLFKDTLIKLEEAIKSKTCEYEERLNQMKQKLEALAH
LQQNLHSFQECGDLDPSGSTSGSLLPPEDHQCRCQESPEVQAGSGDSL
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaaattggtgatgcaaagactttctggatggagctacaagatgatggtaaa
gttgactttatgtttgagaaagcacaagatgtcctacattcactgaaacagaagataaaa
gatgggtctgccacaaatggagactatgtccaagcaatggttctggtaaacgaagcaact
ctgagtaacagtcagacactggaaaaagatcatacacctgtgactcagaatgaacagaaa
aacaaatcaaatgtgtttccctctacatcatgtgaaaacccctcccctgaggactgtatc
attctatctacaggaagaaaaggattcctccctgtgaacaataaaactgaaggttcgggg
gagaaggagccccctttgcatgcatctttccatcaccatgtgtgctccagtgcttgcctg
agggaagcgccactgtccttgaagggagaaaaccctctgcagctgccactcagatgtcac
ttccagagacgacatgcaaagacaaactctccctctgctgccctccatgtaaactataga
acgccctgcggacggagtctacgaaacatggaggaagttttccattacctgcttgaaacg
gagtgtaactttttattcacagacaacttttcttttaatacttatgttcagttaactcgg
aatcacccaaagcaaaatgaagttgtttctgatgtggatattagtaatggagtggaatca
gtgtcgatttctttctgtaatgaggttgacaatagtaaactcccacagtttaagtatagg
acgacagtatggccccgagcatatcatctgaacgtttccagcatgttttctgattcatgt
gactgttctgagggctgcatagacataaaaaagtgtgcatgtcttcagttgacagcaaag
aatgccaaagcatgtcccttgtcacctgacggagaatgtactggatataaatataaaaga
ctgcagagactcataccttctggcatttatgaatgcaacctgttctgcaagtgtaaccga
cagatgtgtcaaaaccgcgtcatccagcatggcccccgggtgaggctgcaggtgttcaaa
agtgagaagaagggctggggagtgcgctgcctggatgacattgacaaagggacatttgtg
tgcatttattcaggaaggttactgagcagagccactcctgagaaaactaacattggtgaa
agtgaaagtgagcagcagcacaccgtgaaaaattcattctctaaaaagaggaaaatagaa
gttgtatgttcagatcgtcaaacacactgtgaaagtcctaaaactgagggatgtcctcct
aagtttagcagtgatctcgaagagcccgttgtggaaatgaataatagaaatatttcaaga
actcagcgtcattcagtcattagaagacctaaatccaagacagatgtttttcattacaat
gagaaaaacatgggattcgtttgctcatattctgctgccccagaagagaagaatggattt
aaaccagctcaagaacacctggactctaaagctaggagagctcacgaggacttaagttca
agccaagttggatattctgaagacaagcagctgactgaatcagatgtgatagatacaact
accagtagagaagacacttccccagcatacgggtgtaagcacgcagccatattgaatagt
aagaacactaaaaaagtgcttgaagtccccgtaaaaacgtcccaagaggaagagcctgca
gcctctcaaagccagcaggtctcgtgtggtgaggagctggcaagtgaaaggacaaagatt
ccatctgcttccctggtgcagctcagtaaggagagtctgtttctattggatgcttcaaaa
gaaggaaatgtgggccgtttccttaatcacagttgctacccaaatctctgggtgcagaac
gtgtttgtagaaacccatgacaggaatttcccattggcggccttcttcaccaacaggtat
gtgaaagcaagaacagaactaacatgggattatggttatgaagctgggaccatgcctgaa
aaggaaatcctctgccaatgtttctgtcaggttacagagaagatggagaagaggacatgt
gtcctctgccctgaaggccacgactggagtgtgatttacttttcaccatcagcaaatata
gctgctcatgagaactgtctgctgtattcatcaggactggtggagtgtgaggcccatgat
ccatttaatatagctaaaaattttgatgtaagttcagtacttgagaagatctggaacgga
agcacgtcgaaatgctcattttgtaataacgagggagccatcatggggtgtgatgaaact
tcctgtgccaagaattaccacttactctgtgccaaggaggaccgcgcaattctacaagtt
ggagtcaaaagaacttacaaaatattttgcccagaacatcctccacaacaagaagagacc
actgaacgtgccaatggcctaagcatcaagaagaggagaggaaggaagaaacgacgttca
ttgggccctcccgcacagccaaaaacgatgaaatgcaggagatctagaagacatgtgaca
ggagaggctctcggccagagagatgcagctgtcaaagctccttttcttaagaaatgcctg
gaagcaggacttcttactgaattatttgaacagatacaacaaaaaatgatttcaattcat
ggaagattcatggatgagactgcttcagagtcagactatgaagggatcgagaccttagtg
tttggctgtggactatttaaagacacattaataaaattagaagaagcaatcaagagtaaa
acttgtgaatatgaagaaaggctgaaccagatgaagcagaagcttgaggcactcgcacac
ttacaacaaaacctgcactcatttcaagaatgtggggacctggacccctcaggctctacc
tcagggtccttgctacctcctgaggaccaccagtgcagatgccaggagtctcctgaagtg
caagcaggctcaggagacagcctgtga

DBGET integrated database retrieval system