KEGG   Rattus norvegicus (rat): 100361710Help
Entry
100361710         CDS       T01003                                 

Gene name
Setdb2
Definition
SET domain, bifurcated 2
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100361710 (Setdb2)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100361710 (Setdb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
15p12
AA seq 1008 aa AA seqDB search
MEEKIGDAKTFWMELQDDGKVDFMFEKAQDVLHSLKQKIKDGSATNGDYVQAMVLVNEAT
LSNSQTLEKDHTPVTQNEQKNKSNVFPSTSCENPSPEDCIILSTGRKGFLPVNNKTEGSG
EKEPPLHASFHHHVCSSACLREAPLSLKGENPLQLPLRCHFQRRHAKTNSPSAALHVNYR
TPCGRSLRNMEEVFHYLLETECNFLFTDNFSFNTYVQLTRNHPKQNEVVSDVDISNGVES
VSISFCNEVDNSKLPQFKYRTTVWPRAYHLNVSSMFSDSCDCSEGCIDIKKCACLQLTAK
NAKACPLSPDGECTGYKYKRLQRLIPSGIYECNLFCKCNRQMCQNRVIQHGPRVRLQVFK
SEKKGWGVRCLDDIDKGTFVCIYSGRLLSRATPEKTNIGESESEQQHTVKNSFSKKRKIE
VVCSDRQTHCESPKTEGCPPKFSSDLEEPVVEMNNRNISRTQRHSVIRRPKSKTDVFHYN
EKNMGFVCSYSAAPEEKNGFKPAQEHLDSKARRAHEDLSSSQVGYSEDKQLTESDVIDTT
TSREDTSPAYGCKHAAILNSKNTKKVLEVPVKTSQEEEPAASQSQQVSCGEELASERTKI
PSASLVQLSKESLFLLDASKEGNVGRFLNHSCYPNLWVQNVFVETHDRNFPLAAFFTNRY
VKARTELTWDYGYEAGTMPEKEILCQCFCQVTEKMEKRTCVLCPEGHDWSVIYFSPSANI
AAHENCLLYSSGLVECEAHDPFNIAKNFDVSSVLEKIWNGSTSKCSFCNNEGAIMGCDET
SCAKNYHLLCAKEDRAILQVGVKRTYKIFCPEHPPQQEETTERANGLSIKKRRGRKKRRS
LGPPAQPKTMKCRRSRRHVTGEALGQRDAAVKAPFLKKCLEAGLLTELFEQIQQKMISIH
GRFMDETASESDYEGIETLVFGCGLFKDTLIKLEEAIKSKTCEYEERLNQMKQKLEALAH
LQQNLHSFQECGDLDPSGSTSGSLLPPEDHQCRCQESPEVQAGSGDSL
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaaattggtgatgcaaagactttctggatggagctacaagatgatggtaaa
gttgactttatgtttgagaaagcacaagatgtcctacattcactgaaacagaagataaaa
gatgggtctgccacaaatggagactatgtccaagcaatggttctggtaaacgaagcaact
ctgagtaacagtcagacactggaaaaagatcatacacctgtgactcagaatgaacagaaa
aacaaatcaaatgtgtttccctctacatcatgtgaaaacccctcccctgaggactgtatc
attctatctacaggaagaaaaggattcctccctgtgaacaataaaactgaaggttcgggg
gagaaggagccccctttgcatgcatctttccatcaccatgtgtgctccagtgcttgcctg
agggaagcgccactgtccttgaagggagaaaaccctctgcagctgccactcagatgtcac
ttccagagacgacatgcaaagacaaactctccctctgctgccctccatgtaaactataga
acgccctgcggacggagtctacgaaacatggaggaagttttccattacctgcttgaaacg
gagtgtaactttttattcacagacaacttttcttttaatacttatgttcagttaactcgg
aatcacccaaagcaaaatgaagttgtttctgatgtggatattagtaatggagtggaatca
gtgtcgatttctttctgtaatgaggttgacaatagtaaactcccacagtttaagtatagg
acgacagtatggccccgagcatatcatctgaacgtttccagcatgttttctgattcatgt
gactgttctgagggctgcatagacataaaaaagtgtgcatgtcttcagttgacagcaaag
aatgccaaagcatgtcccttgtcacctgacggagaatgtactggatataaatataaaaga
ctgcagagactcataccttctggcatttatgaatgcaacctgttctgcaagtgtaaccga
cagatgtgtcaaaaccgcgtcatccagcatggcccccgggtgaggctgcaggtgttcaaa
agtgagaagaagggctggggagtgcgctgcctggatgacattgacaaagggacatttgtg
tgcatttattcaggaaggttactgagcagagccactcctgagaaaactaacattggtgaa
agtgaaagtgagcagcagcacaccgtgaaaaattcattctctaaaaagaggaaaatagaa
gttgtatgttcagatcgtcaaacacactgtgaaagtcctaaaactgagggatgtcctcct
aagtttagcagtgatctcgaagagcccgttgtggaaatgaataatagaaatatttcaaga
actcagcgtcattcagtcattagaagacctaaatccaagacagatgtttttcattacaat
gagaaaaacatgggattcgtttgctcatattctgctgccccagaagagaagaatggattt
aaaccagctcaagaacacctggactctaaagctaggagagctcacgaggacttaagttca
agccaagttggatattctgaagacaagcagctgactgaatcagatgtgatagatacaact
accagtagagaagacacttccccagcatacgggtgtaagcacgcagccatattgaatagt
aagaacactaaaaaagtgcttgaagtccccgtaaaaacgtcccaagaggaagagcctgca
gcctctcaaagccagcaggtctcgtgtggtgaggagctggcaagtgaaaggacaaagatt
ccatctgcttccctggtgcagctcagtaaggagagtctgtttctattggatgcttcaaaa
gaaggaaatgtgggccgtttccttaatcacagttgctacccaaatctctgggtgcagaac
gtgtttgtagaaacccatgacaggaatttcccattggcggccttcttcaccaacaggtat
gtgaaagcaagaacagaactaacatgggattatggttatgaagctgggaccatgcctgaa
aaggaaatcctctgccaatgtttctgtcaggttacagagaagatggagaagaggacatgt
gtcctctgccctgaaggccacgactggagtgtgatttacttttcaccatcagcaaatata
gctgctcatgagaactgtctgctgtattcatcaggactggtggagtgtgaggcccatgat
ccatttaatatagctaaaaattttgatgtaagttcagtacttgagaagatctggaacgga
agcacgtcgaaatgctcattttgtaataacgagggagccatcatggggtgtgatgaaact
tcctgtgccaagaattaccacttactctgtgccaaggaggaccgcgcaattctacaagtt
ggagtcaaaagaacttacaaaatattttgcccagaacatcctccacaacaagaagagacc
actgaacgtgccaatggcctaagcatcaagaagaggagaggaaggaagaaacgacgttca
ttgggccctcccgcacagccaaaaacgatgaaatgcaggagatctagaagacatgtgaca
ggagaggctctcggccagagagatgcagctgtcaaagctccttttcttaagaaatgcctg
gaagcaggacttcttactgaattatttgaacagatacaacaaaaaatgatttcaattcat
ggaagattcatggatgagactgcttcagagtcagactatgaagggatcgagaccttagtg
tttggctgtggactatttaaagacacattaataaaattagaagaagcaatcaagagtaaa
acttgtgaatatgaagaaaggctgaaccagatgaagcagaagcttgaggcactcgcacac
ttacaacaaaacctgcactcatttcaagaatgtggggacctggacccctcaggctctacc
tcagggtccttgctacctcctgaggaccaccagtgcagatgccaggagtctcctgaagtg
caagcaggctcaggagacagcctgtga

DBGET integrated database retrieval system