KEGG   Rattus norvegicus (rat): 100362548Help
Entry
100362548         CDS       T01003                                 

Definition
rCG52086-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100362548
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100362548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
15
AA seq 547 aa AA seqDB search
MKQKRKGDLSPAELMMLTIGDVIKQLVEAHEQGKDVDLNKLKTKTASKYGLSSQPRLVDI
IAAVPPHYRKILIPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPYLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRNLHDALSGHTSNNIYEAIKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQ
FIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYRSYSPSDLIELVARILALVPPWT
RVYRVQRDIPMPLVSSGVDHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHRVRPYQV
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIALEEHGSGKIAVISGVGTRNYYRKMGYRLQGP
YMVKMLK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaagaggaaaggggatctcagcccggctgagctgatgatgctgactatagga
gacgtgatcaagcagctggttgaagctcatgaacaaggcaaggacgtcgatctaaataag
ctgaaaaccaaaacagcttccaagtatggcctgtcgtcccagcctcgcctggtggatatc
attgctgcagtccctcctcactatcgaaagatcttgattcccaagctaaaggcaaagccc
atcaggactgccagtgggattgctgttgtggctgtgatgtgcaaaccccacagatgtcca
cacatcagttttacagggaatatatgtgtatactgccctggaggacctgactcagatttt
gagtactcaacccagtcttacacgggctatgagccaacttccatgcgagctatccgtgct
agatacgacccttatctgcagacaagacaccggatagagcagctaaagcagcttggccac
agtgtggataaggtggagttcatcgtgatgggcggaacgttcatggcccttccggaggaa
tacagagattattttatccgaaatttacacgatgctttatcaggacatacttcaaacaat
atttacgaggcaatcaagtattccgagagaagcctcacaaagtgcatagggattaccatt
gagaccagacctgattactgcatgaagcggcacctaagtgacatgttgacttacggctgc
acaaggctggagattggagtgcagagtgtctatgaagatgtggccagagataccaacagg
ggccacaccgtgaaggcagtatgtgaatcattccacctggccaaagattctgggttcaaa
gtggtggcgcacatgatgcctgacctgccgaatgtgggactagagagagacattgagcag
tttatagaattttttgagaaccctgcttttcgtcctgatggtttgaagctctaccctacc
ctggtgatccgtggaactggtctgtatgagctgtggaaatcagggagatacaggagctat
tctcccagtgatctgattgagttggtggctcggatcctagccctcgtgcccccttggact
cgtgtgtaccgagtgcagagagacattccaatgcccctcgtcagctcaggagtagaccat
ggcaaccttcgagagctggcatttgcaagaatgaaagatcttgggatacagtgccgagat
gtgagaaccagggaggttggaatccaagaaattcatcacagagtgcggccgtaccaggtt
gagttggtacggagagattatgttgccaatggcggctgggagaccttcctttcctacgaa
gatcccgatcaggacattctaattggcctcctaaggctacggaaatgctctgaggaaacc
ttccgatttgaactgggtggaggcgtttccatagtccgagagctacatgtgtatggaagt
gtggtccctgtgagcagccgggaccccactaaatttcagcatcaggggttcggcatgctg
ctgatggaagaagcagaaagaatcgctctggaagagcacgggtctgggaaaatcgcagtt
atatcaggagtcggcacaagaaattactaccgaaagatgggctacagattgcaaggcccg
tacatggtaaagatgctaaaataa

DBGET integrated database retrieval system