KEGG   Rattus norvegicus (rat): 100363502Help
Entry
100363502         CDS       T01003                                 

Definition
(RefSeq) cytochrome c, somatic-like
  KO
K08738  cytochrome c
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer's disease
rno05012  Parkinson's disease
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05016  Huntington's disease
rno05134  Legionellosis
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05164  Influenza A
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05168  Herpes simplex infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05222  Small cell lung cancer
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100363502
   04215 Apoptosis - multiple species
    100363502
   04115 p53 signaling pathway
    100363502
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100363502
   05210 Colorectal cancer
    100363502
   05222 Small cell lung cancer
    100363502
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100363502
   05012 Parkinson's disease
    100363502
   05014 Amyotrophic lateral sclerosis (ALS)
    100363502
   05016 Huntington's disease
    100363502
  Cardiovascular diseases
   05416 Viral myocarditis
    100363502
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100363502
  Infectious diseases
   05134 Legionellosis
    100363502
   05152 Tuberculosis
    100363502
   05164 Influenza A
    100363502
   05161 Hepatitis B
    100363502
   05168 Herpes simplex infection
    100363502
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100363502
   05145 Toxoplasmosis
    100363502
  Drug resistance
   01524 Platinum drug resistance
    100363502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Motif
Other DBs
NCBI-GeneID: 100363502
NCBI-ProteinID: XP_003751847
RGD: 2322845
Ensembl: ENSRNOG00000032885
UniProt: P62898
Structure
PDB: 

Jmol
Position
18q12.1
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgaaaaaggcaagaagatttttgttcaaaagtgtgcccagtgccacact
gtggaaaaaggaggcaagcataagactggaccaaacctccatggtctgtttgggcggaag
acaggccaggctgctggattctcttacacagatgccaacaagaacaaaggtatcacctgg
ggagaggataccctgatggagtatttggaaaatcccaaaaagtacatccctggaacaaaa
atgatcttcgctggaattaagaagaagggagaaagggcagacctaatagcttatcttaaa
aaggctactaatgaataa

DBGET integrated database retrieval system