KEGG   Rattus norvegicus (rat): 100364835Help
Entry
100364835         CDS       T01003                                 

Definition
histone cluster 1, H2bd-like
Orthology
K11252  
histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100364835
  Immune diseases
   05322 Systemic lupus erythematosus
    100364835
  Substance dependence
   05034 Alcoholism
    100364835
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100364835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
17
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcccgccaagtccgctcccgccccgaagaagggctccaagaaggccgttacc
aaggcccagaagaaagacggcaagaagcgcaagcgcagccgcaaggagagctattccgtg
tacgtgtacaaggtgctgaagcaagtgcacccggataccggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgaacgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgcggtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system