KEGG   Rattus norvegicus (rat): 100909840Help
Entry
100909840         CDS       T01003                                 

Definition
profilin-2-like
Orthology
K05759  
profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100909840
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100909840
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100909840
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   100909840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
2
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPAEIDVIIGKDREGFF
TNGLTLGGKKCSVIRDSLYVDSDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc
cagagcatcacgccagcagaaatagatgtgattataggaaaagaccgggaaggtttcttt
accaatggtttgactcttggaggaaagaagtgctctgtgatcagagatagcctatacgtt
gactcggactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac
gttgctgttggcagagctgggagagtcttggtctttgtaatgggaaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

DBGET integrated database retrieval system