KEGG   Rattus norvegicus (rat): 100911494Help
Entry
100911494         CDS       T01003                                 

Definition
pancreatic alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100911494
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100911494
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100911494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2
AA seq 508 aa AA seqDB search
MKFVLLLSLIGFCWAQYDPHTADGRTAIVHLFEWRWADIAKECERYLAPKGFGGVQVSPP
NENIIINNPSRPWWERYQPISYKICSRSGNENEFKDMVTRCNNVGVRIYVDAVINHMCGS
GNSAGTHSTCGSYFNPNNREFSAVPYSAWDFNDNKCNGEINNYNDANQVRNCRLSGLLDL
ALDKDYVRTKVADYMNNLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRP
FIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVP
TDRALVFVDNHDNQRGHGAGGASILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWARNF
QNGKDVNDWIGPPNNNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFAN
WWDNGSNQVAFSRGNRGFIVFNNDDWALSSTLQTGLPAGTYCDVISGDKVNGNCTGLKVN
VGSDGKAHFSISNSAEDPFIAIHADSKL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgttctgctgctttccctcattgggttctgctgggctcaatatgacccacac
actgcggatgggaggactgctattgtccacctgttcgagtggcgctgggctgatattgcc
aaggaatgtgagcggtacttagcacctaagggatttggaggggtgcaggtctctccaccc
aatgaaaatattataattaataatccatcaaggccttggtgggaaagatatcaaccaatc
agctacaaaatttgctcaaggtctggaaatgaaaatgaattcaaagacatggtgacgagg
tgcaacaatgttggtgtccggatttatgtggatgctgtcattaatcacatgtgtggctcg
ggcaatagtgcaggaacacacagtacctgtggaagttacttcaatcctaataacagggaa
ttctcagcagttccatactctgcttgggattttaacgataataaatgtaatggagaaatt
aataactacaatgatgccaatcaggtcagaaattgtcgtctgtctggccttctggatctt
gcactcgataaagattatgttcgaaccaaggtggctgactatatgaacaatctcattgac
attggtgtagcagggttcagacttgatgctgctaagcacatgtggcctggagacataaag
gcagttttggacaaactacataatctaaatacaaaatggttctcccaaggaagcagacct
ttcattttccaagaggtcattgatcttggtggtgaagcaattaaaggtagtgagtacttt
ggaaatggccgcgtgacagaattcaagtatggtgcaaaacttggcacagttattcgcaaa
tggaatggagagaagatgtcttacttaaagaactggggagaaggttggggttttgtgcct
actgacagagcccttgtgtttgtggacaaccatgacaatcagcgaggacatggtgctgga
ggagcatccatcctgacattctgggatgctagaatgtataaaatggcagttggatttatg
ttggctcatccttatggattcaccagagtaatgtcaagttaccgatgggcaagaaatttc
cagaatggaaaagatgtgaatgactggattggaccacctaataacaatggagtaacaaaa
gaagtgaccattaatccagacactacttgtggcaatgactgggtctgtgaacatcgatgg
cgtcaaatcaggaacatggttgccttcaggaatgtagtcaacggtcagccttttgcaaac
tggtgggataatggcagcaaccaagtggcttttagcagaggaaacagaggattcattgtc
tttaacaatgatgactgggctttgtcaagcactctacagactggtcttcctgctggcaca
tactgtgatgtcatttcaggagataaagtcaatggcaattgcactggacttaaagtaaat
gttggcagtgatggcaaagctcacttctctattagtaactctgctgaagacccattcatt
gcaatccatgccgactcaaagttgtaa

DBGET integrated database retrieval system