KEGG   Rattus norvegicus (rat): 100911825Help
Entry
100911825         CDS       T01003                                 

Definition
low affinity immunoglobulin gamma Fc region receptor III-like
Orthology
K16824  
low affinity immunoglobulin gamma Fc region receptor II-c
Organism
rno  Rattus norvegicus (rat)
Pathway
Phagosome
Osteoclast differentiation
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100911825
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    100911825
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    100911825
   05152 Tuberculosis
    100911825
   05140 Leishmaniasis
    100911825
Cellular antigens [BR:rno04090]
 Proteins
  100911825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
13
AA seq 267 aa AA seqDB search
MTLETQMFQNAHSGSQWLLPPLTMLLLFAFADRQTGDLLKAVVKRDPPWIQVLKDDTVTL
TCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPIHLEVI
SDWLLLQTPQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYYQSSNFSIPKANHS
HSGNYYCKAYLGRTMHVSKPVTITVQGSATASTSSLVWFHAAFCLVMCLLFAVDTGLYFC
VRRNLQTSGEDWRKSLSVGKYKAPQDK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactttggagacccagatgtttcagaatgcacattctggaagccaatggctactccca
ccactgacaatgttgctgctgtttgcttttgcagacaggcagacgggagatcttctgaag
gctgtggtgaaacgtgatcccccatggatccaggtgctcaaggacgacactgtgacgctg
acgtgcgaagggacccacaatcctggaaactcttctacccagtggttccacaaccagagc
tccacctggggccaggtccaagccagctacacgtttaaggccacagtcaatgacagtgga
gaataccggtgccgaatggcgcacaccagcctcagcgaccccatacatctggaagtgatt
tctgactggctgctgctccagacccctcaactggtgtttgaggaaggggaaaccatcaca
ttaaggtgccatagctggaagaacaaacagctgactaaggtcttgttgttccagaatgga
aaacctgtgaggtattattatcaaagcagcaatttttcaatccccaaagccaaccacagt
cacagtgggaactactactgcaaagcatatctaggaaggacaatgcatgtgtccaagcct
gtcaccatcactgtccaaggttcagcaaccgcgtccaccagctctctagtgtggttccat
gccgctttctgcctagtgatgtgcctcctgtttgcagtggacaccggcctgtatttctgt
gtacggagaaatcttcaaacctcgggggaggactggaggaaatccctgtcagtcggaaag
tacaaggctccacaggacaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system