KEGG   Rattus norvegicus (rat): 100911825Help
Entry
100911825         CDS       T01003                                 

Definition
(RefSeq) low affinity immunoglobulin gamma Fc region receptor III-like
  KO
K16824  low affinity immunoglobulin gamma Fc receptor II-c
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno05140  Leishmaniasis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100911825
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    100911825
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    100911825
   05152 Tuberculosis
    100911825
   05140 Leishmaniasis
    100911825
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    100911825
CD molecules [BR:rno04090]
 Proteins
  100911825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig I-set Ig_4 Ig_5
Motif
Other DBs
NCBI-GeneID: 100911825
NCBI-ProteinID: XP_008767996
RGD: 6490558
Ensembl: ENSRNOG00000046663
UniProt: P27645 B0K007
Position
13q24
AA seq 267 aa AA seqDB search
MTLETQMFQNAHSGSQWLLPPLTMLLLFAFADRQTGDLLKAVVKRDPPWIQVLKDDTVTL
TCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPIHLEVI
SDWLLLQTPQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYYQSSNFSIPKANHS
HSGNYYCKAYLGRTMHVSKPVTITVQGSATASTSSLVWFHAAFCLVMCLLFAVDTGLYFC
VRRNLQTSGEDWRKSLSVGKYKAPQDK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactttggagacccagatgtttcagaatgcacattctggaagccaatggctactccca
ccactgacaatgttgctgctgtttgcttttgcagacaggcagacgggagatcttctgaag
gctgtggtgaaacgtgatcccccatggatccaggtgctcaaggacgacactgtgacgctg
acgtgcgaagggacccacaatcctggaaactcttctacccagtggttccacaaccagagc
tccacctggggccaggtccaagccagctacacgtttaaggccacagtcaatgacagtgga
gaataccggtgccgaatggcgcacaccagcctcagcgaccccatacatctggaagtgatt
tctgactggctgctgctccagacccctcaactggtgtttgaggaaggggaaaccatcaca
ttaaggtgccatagctggaagaacaaacagctgactaaggtcttgttgttccagaatgga
aaacctgtgaggtattattatcaaagcagcaatttttcaatccccaaagccaaccacagt
cacagtgggaactactactgcaaagcatatctaggaaggacaatgcatgtgtccaagcct
gtcaccatcactgtccaaggttcagcaaccgcgtccaccagctctctagtgtggttccat
gccgctttctgcctagtgatgtgcctcctgtttgcagtggacaccggcctgtatttctgt
gtacggagaaatcttcaaacctcgggggaggactggaggaaatccctgtcagtcggaaag
tacaaggctccacaggacaaatga

DBGET integrated database retrieval system