KEGG   Rattus norvegicus (rat): 100912430Help
Entry
100912430         CDS       T01003                                 

Definition
glutathione S-transferase Mu 5-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rno00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:rno00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:rno00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:rno05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
2
AA seq 225 aa AA seqDB search
MSCSKSMVLGYWDIRGLAHAIRMLLEFTDTSYEEKQYTCGEAPDYDRSQWLDVKFKLDLD
FPNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRLCY
NSNHESLKPQYLEQLPAQLKQFSLFLGKFTWFAGEKLTFVDFLTYDVLDQNRMFEPKCLD
EFPNLKAFMCRFEALEKIAAFLQSDRCFKMPINNKMAKWGNKSIC
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgctccaagtctatggttctgggttactgggatatccgcgggctggctcatgcc
atccgtatgctcctggagtttactgataccagctatgaagagaaacagtacacgtgtggg
gaagctcctgactatgatagaagccaatggctggacgtgaaattcaagctagatctggat
tttcctaacctgccctaccttatggacgggaagaacaagatcacccagagtaacgccatc
ttgcggtacatcgcacgcaagcacaacatgtgtggtgacaccgaagaagaaaagattcga
gtggacatcatggagaaccagataatggacttccgcatgcagctggttcggctctgctac
aattctaaccacgaaagcctgaagcctcagtatttggaacaactgcctgcacagctgaaa
cagttctcgttgttcctggggaaattcacatggtttgcaggagaaaagctgaccttcgtg
gattttctcacttatgacgtcttggaccagaatcgtatgtttgagcccaagtgcctggat
gagttcccaaatctgaaggctttcatgtgccgttttgaggctttggagaagattgctgca
ttcctgcagtctgaccgctgcttcaagatgccaatcaacaacaagatggccaagtggggt
aacaagagcatatgctga

DBGET integrated database retrieval system