KEGG   Rattus norvegicus (rat): 100912585Help
Entry
100912585         CDS       T01003                                 

Definition
(RefSeq) mitogen-activated protein kinase 7-like
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04540  Gap junction
rno04657  IL-17 signaling pathway
rno04722  Neurotrophin signaling pathway
rno04912  GnRH signaling pathway
rno04921  Oxytocin signaling pathway
rno05206  MicroRNAs in cancer
rno05418  Fluid shear stress and atherosclerosis
Module
rno_M00690  MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100912585
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100912585
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    100912585
  Endocrine system
   04912 GnRH signaling pathway
    100912585
   04921 Oxytocin signaling pathway
    100912585
  Nervous system
   04722 Neurotrophin signaling pathway
    100912585
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100912585
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100912585
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100912585
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100912585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 100912585
NCBI-ProteinID: XP_006246617
RGD: 6486357
Ensembl: ENSRNOG00000047907
UniProt: E9PTH2
Position
10q23
AA seq 812 aa AA seqDB search
MAEPLKEEDGEDGSGEPPGRVKAEPVHSAASVVAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFRSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPVCPDVEMP
SPWAPSGDCAMESPPPALPPCSGPAPDTVDLTLQPAPPASELAPPKREGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGTLGGPSTDPLAGLVLSDNDRSLLERWTRMARPPVPAPAPAPAPTPKPTPTPTQS
SAQPTSPPNGPVSQSTAPLQPAGSIPGPASQPVCPPPGPVPQPAGPVPAPLQTAPSTSLL
ASQSLVPPSGLPGSGAPEVLPYFPSGPPPPDPGLTPQPSTSESPDVNLVTQQLSKSQVED
PLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDSQADSASLSASLLADWLEG
HGMNPADIESLQREIQMDSPMLLSDLPDLQEP
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaccgttgaaggaggaggacggcgaagatggctctggggaaccccctgggcgg
gtgaaggcagaacccgtccactccgctgcatctgtcgtggccaagaacctggccctgctc
aaagcccgctccttcgacgtgacctttgacgtgggggacgagtacgagatcatcgagacc
ataggcaatggggcctacggggtggtgtcctcggcgcgccgccgcctcacgggtcagcag
gtggccatcaagaagatacctaatgcttttgatgtggtgaccaatgccaaacggaccctc
agggaactgaagatcctcaaacacttcaaacacgacaatatcatcgccatcaaggacatc
ctgaggcccactgtgccctatggagaattcagatctgtctacgtggtactggacctcatg
gaaagtgacctacaccagatcattcactcttcacagccgctcacactagaacatgtgaga
tacttcctataccagctgcttcggggcctcaaatacatgcactctgctcaggtcatccac
cgcgatcttaaaccctctaaccttttggtcaatgagaactgtgagctcaagattggtgac
tttggaatggcccgtggcctgtgtacatcccctgccgagcaccagtacttcatgactgag
tatgtggccactcgctggtaccgtgctcctgaactcatgctttcgctgcatgagtacaca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggctcggcgacag
ctcttcccaggcaaaaactatgtgcatcagttacagctgatcatgatggtgttgggaact
ccatcaccagctgtgattcaggctgtgggggctgaaagggtgcgagcctatatccagagc
ctgccaccaaggcagcctgtaccttgggagacagtatacccgggtgctgaccgccaggcc
ctctcactgctgggacgcatgttgcgatttgaacccagtgcccgaatctcagctgctgct
gcccttcgccaccccttcctggctaagtaccacgaccctgacgatgagcctgattgcgcc
ccaccttttgactttgcttttgaccgtgaagcccttaccagggagcgcattaaggaggcc
attgtggctgagattgaggacttccatgcacgacgggagggcatccgccaacaaattcgc
ttccagccctctttgcagcctgtggctagtgagcctgtgtgtccagatgtcgagatgccc
agcccctgggctccaagtggagactgtgccatggagtcacctcctccagcactaccacca
tgctctggccctgcccctgacactgttgatctgactctgcagcctgccccgcccgccagt
gagcttgctccgccaaaaagagagggtgccatctccgacaataccaaagcagccctcaaa
gctgctctgctcaagtccctgaggagccggcttcgagatgggcccagtgcacccttggag
gcccctgaacctcgaaagcctgtgacagctcaggaacgtcagcgagagcgagaagagaag
cgcaggaggcgacaagagagagccaaggagagggagaagcgacgacaagagcgggagcgc
aaggagaggggggctggcaccttggggggcccctctactgaccctttggctggattggtg
ctcagtgacaatgaccgaagcctgctagagcggtggactcgcatggctaggcctcctgtc
cctgcaccagcaccagcaccagcaccaacaccaaaaccaacaccaacaccaacacagtcc
tctgctcaacccactagtcctcccaatggccctgtatctcagtctactgctcctctacag
cctgcaggctctattcctggtcctgcctcccagcctgtttgcccaccccctgggcctgtt
ccccagcctgctggccctgtccctgcccctctccagactgccccttccactagccttttg
gcctcccagtcacttgtgccacctagtgggttgcctggttctggtgccccagaagttctg
ccttacttcccatctggcccaccacctccagatcctgggctcacccctcagccttctaca
tcagagtcacctgatgtcaacctggtgacccagcaactgtccaagtctcaggtggaggac
cccctgcctcccgtgttctcaggcactccaaagggcagtggggctggctacggtgttggc
tttgacctggaggaattcttaaaccaatcttttgacatgggtgtggctgatgggccacag
gatagccaggcagactcagcctcactctcagcctccctccttgctgactggcttgagggc
cacggcatgaaccccgctgacattgagtctctgcagcgtgagatccagatggactcccca
atgttgctgtctgacctgcctgacctccaagaaccctga

DBGET integrated database retrieval system