KEGG   Rattus norvegicus (rat): 113902Help
Entry
113902            CDS       T01003                                 

Gene name
Ces1d, Ces3
Definition
carboxylesterase 1D (EC:3.1.1.1 3.1.1.67)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:rno00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
19p11
AA seq 565 aa AA seqDB search
MRLYPLVWLFLAACTAWGYPSSPPVVNTVKGKVLGKYVNLEGFAQPVAVFLGIPFAKPPL
GSLRFAPPQPAEPWNFVKNTTSYPPMCSQDAVGGQVLSELFTNRKENIPLQFSEDCLYLN
VYTPADLTKNSRLPVMVWIHGGGLVVGGASTYDGQVLSAHENVVVVTIQYRLGIWGFFST
GDEHSQGNWGHLDQVAALHWVQDNIANFGGNPGSVTIFGESAGGFSVSALVLSPLAKNLF
HRAISESGVVLTSALITTDSKPIANLIATLSGCKTTTSAVMVHCLRQKTEDELLETSLKL
NLFKLDLLGNPKESYPFLPTVIDGVVLPKTPEEILTEKSFNTVPYIVGINKQEFGWIIPT
LMGYPLSEGKLDQKTAKSLLWKSYPTLKISEKMIPVVAEKYFGGTDDPAKRKDLFQDLVA
DVMFGVPSVMVSRSHRDAGAPTFMYEFEYRPSFVSAMRPKTVIGDHGDELFSVFGSPFLK
DGASEEETNLSKMVMKYWANFARNGSPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDK
EVAFWSELRAKEAAEEPSHWKHVEL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctctaccctctggtctggctttttcttgctgcgtgcacagcttgggggtaccca
tcctcaccacctgtggtgaacactgttaaaggcaaagtcctggggaagtatgtcaatttg
gaaggatttgcacagcctgtggctgttttcctgggaatccccttcgccaagccccctctt
ggctccttgaggtttgctccaccacagcctgcagagccttggaactttgtgaagaatact
acctcctacccacctatgtgctctcaagatgctgttggagggcaggttctctcagagctt
ttcaccaacaggaaggaaaacattcctttacagttttctgaagactgcctctacctgaac
gtttatactcccgctgacttgacaaagaacagccggctaccagtgatggtgtggatccat
ggaggtggactggtagtgggtggagcatccacctatgatggacaggtcctctctgcccat
gaaaatgtggtggtggtgaccattcagtatcgccttggcatctggggattcttcagcaca
ggggatgaacacagccagggcaactggggtcacttggaccaggtggctgcactacactgg
gtccaggacaacattgccaactttgggggtaacccaggctctgtgaccatctttggagaa
tctgcaggaggtttcagtgtctctgctcttgtgttatctcctctggccaagaacctcttc
cacagggccatttctgagagtggtgtggtcctcacttctgctctgattacaacagatagc
aagcccattgctaatctgattgctactctttctgggtgtaaaaccaccacatcagctgtt
atggttcattgcctgcgccagaagacagaggatgaactcctggagacttcattaaaattg
aatcttttcaaactggatttacttggaaacccaaaagagagctatcccttcctacctact
gtgattgacggagtggtgctgccaaagacaccagaagagatcctgactgagaagagtttc
aacacagtcccctacatagtgggcatcaacaagcaagagtttggctggatcattccaacg
cttatgggctatccactctccgaaggcaaactggaccagaaaacagccaaatccctcttg
tggaagtcctacccaacactgaaaatctctgagaaaatgattccagtggttgctgagaag
tacttcggagggacagatgaccctgccaaaaggaaagacctgttccaggacttggttgca
gatgtgatgtttggtgtcccatcagtaatggtgtctcgaagtcacagagatgctggagcc
cccaccttcatgtatgaatttgagtatcgcccaagctttgtatcagccatgaggcccaag
acagtgatcggagaccatggtgatgaactcttctcagtatttggatctccatttttaaaa
gatggtgcctcagaagaggagaccaatctcagcaaaatggtgatgaaatactgggccaac
tttgctcggaatgggagccctaatgggggagggctgccccattggccagaatatgaccag
aaggaagggtacctgaagattggtgcctcaactcaggcagcccagaggctgaaggacaaa
gaagtggctttttggtctgagctcagggccaaggaggcagcagaggaaccatcccactgg
aaacatgttgagctctga

DBGET integrated database retrieval system