KEGG   Rattus norvegicus (rat): 113902Help
Entry
113902            CDS       T01003                                 

Gene name
Ces1d, Ces3
Definition
(RefSeq) carboxylesterase 1D
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    113902 (Ces1d)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     113902 (Ces1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Esterase Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 113902
NCBI-ProteinID: NP_579829
RGD: 70896
Ensembl: ENSRNOG00000015519
UniProt: P16303
Position
19p11
AA seq 565 aa AA seqDB search
MRLYPLVWLFLAACTAWGYPSSPPVVNTVKGKVLGKYVNLEGFAQPVAVFLGIPFAKPPL
GSLRFAPPQPAEPWNFVKNTTSYPPMCSQDAVGGQVLSELFTNRKENIPLQFSEDCLYLN
VYTPADLTKNSRLPVMVWIHGGGLVVGGASTYDGQVLSAHENVVVVTIQYRLGIWGFFST
GDEHSQGNWGHLDQVAALHWVQDNIANFGGNPGSVTIFGESAGGFSVSALVLSPLAKNLF
HRAISESGVVLTSALITTDSKPIANLIATLSGCKTTTSAVMVHCLRQKTEDELLETSLKL
NLFKLDLLGNPKESYPFLPTVIDGVVLPKTPEEILTEKSFNTVPYIVGINKQEFGWIIPT
LMGYPLSEGKLDQKTAKSLLWKSYPTLKISEKMIPVVAEKYFGGTDDPAKRKDLFQDLVA
DVMFGVPSVMVSRSHRDAGAPTFMYEFEYRPSFVSAMRPKTVIGDHGDELFSVFGSPFLK
DGASEEETNLSKMVMKYWANFARNGSPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDK
EVAFWSELRAKEAAEEPSHWKHVEL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctctaccctctggtctggctttttcttgctgcgtgcacagcttgggggtaccca
tcctcaccacctgtggtgaacactgttaaaggcaaagtcctggggaagtatgtcaatttg
gaaggatttgcacagcctgtggctgttttcctgggaatccccttcgccaagccccctctt
ggctccttgaggtttgctccaccacagcctgcagagccttggaactttgtgaagaatact
acctcctacccacctatgtgctctcaagatgctgttggagggcaggttctctcagagctt
ttcaccaacaggaaggaaaacattcctttacagttttctgaagactgcctctacctgaac
gtttatactcccgctgacttgacaaagaacagccggctaccagtgatggtgtggatccat
ggaggtggactggtagtgggtggagcatccacctatgatggacaggtcctctctgcccat
gaaaatgtggtggtggtgaccattcagtatcgccttggcatctggggattcttcagcaca
ggggatgaacacagccagggcaactggggtcacttggaccaggtggctgcactacactgg
gtccaggacaacattgccaactttgggggtaacccaggctctgtgaccatctttggagaa
tctgcaggaggtttcagtgtctctgctcttgtgttatctcctctggccaagaacctcttc
cacagggccatttctgagagtggtgtggtcctcacttctgctctgattacaacagatagc
aagcccattgctaatctgattgctactctttctgggtgtaaaaccaccacatcagctgtt
atggttcattgcctgcgccagaagacagaggatgaactcctggagacttcattaaaattg
aatcttttcaaactggatttacttggaaacccaaaagagagctatcccttcctacctact
gtgattgacggagtggtgctgccaaagacaccagaagagatcctgactgagaagagtttc
aacacagtcccctacatagtgggcatcaacaagcaagagtttggctggatcattccaacg
cttatgggctatccactctccgaaggcaaactggaccagaaaacagccaaatccctcttg
tggaagtcctacccaacactgaaaatctctgagaaaatgattccagtggttgctgagaag
tacttcggagggacagatgaccctgccaaaaggaaagacctgttccaggacttggttgca
gatgtgatgtttggtgtcccatcagtaatggtgtctcgaagtcacagagatgctggagcc
cccaccttcatgtatgaatttgagtatcgcccaagctttgtatcagccatgaggcccaag
acagtgatcggagaccatggtgatgaactcttctcagtatttggatctccatttttaaaa
gatggtgcctcagaagaggagaccaatctcagcaaaatggtgatgaaatactgggccaac
tttgctcggaatgggagccctaatgggggagggctgccccattggccagaatatgaccag
aaggaagggtacctgaagattggtgcctcaactcaggcagcccagaggctgaaggacaaa
gaagtggctttttggtctgagctcagggccaaggaggcagcagaggaaccatcccactgg
aaacatgttgagctctga

DBGET integrated database retrieval system