KEGG   Rattus norvegicus (rat): 113919Help
Entry
113919            CDS       T01003                                 

Gene name
Gpx5
Definition
glutathione peroxidase 5 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    113919 (Gpx5)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    113919 (Gpx5)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    113919 (Gpx5)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     113919 (Gpx5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
17q11
AA seq 221 aa AA seqDB search
MAIQLRVFYLVPLLLASYVQTTPRLEKMKMDCYKDVKGTIYNYEALSLNGKERIPFKQYA
GKHVLFVNVATYCGLTIQYPELNALQDDLKQFGLVILGFPCNQFGKQEPGDNTEILPGLK
YVRPGKGFLPNFQLFAKGDVNGEKEQEIFTFLKRSCPHPSETVVTSKHTFWEPIKVHDIR
WNFEKFLVGPNGVPVMRWFHQAPVSTVKSDILAYLNQFKTI
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctatacagctaagagtcttctatctcgttccacttcttctagccagctatgtgcag
acaacccccaggctggaaaagatgaagatggactgctacaaagatgtgaaaggcaccatc
tacaactacgaggctctgtctcttaatgggaaggaacgcattccattcaagcagtatgca
ggaaagcatgtcctctttgtcaatgtggctacctattgtggtctgacaattcagtatcct
gaactgaatgcactccaggatgatctgaagcaatttggcttggttatattgggctttccc
tgcaaccaatttggaaagcaagaaccaggagacaatacagagattcttcctgggctcaag
tatgttcgtccgggaaaaggatttttacctaatttccagctttttgcgaaaggggatgta
aatggtgaaaaagagcaggaaatctttaccttcttgaagcgctcctgtcctcacccctca
gagactgtggtcacaagcaaacatacattctgggagccaataaaagtccatgacatccgc
tggaactttgagaagtttctggtgggacccaacggtgtccctgtcatgcgctggttccac
caggctcctgtcagcactgtcaagtctgacatcctggcgtacctgaatcaattcaaaacc
atatag

DBGET integrated database retrieval system