KEGG   Rattus norvegicus (rat): 113975Help
Entry
113975            CDS       T01003                                 

Gene name
Pom121
Definition
POM121 transmembrane nucleoporin
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
rno  Rattus norvegicus (rat)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    113975 (Pom121)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     113975 (Pom121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
12q12
AA seq 1199 aa AA seqDB search
MSPAAAAADGGERRRPPLGVREGRGRTRGCGGPAGAAALGLALLGLALYLVPAAAALAWL
AVGASAAWWGLSREPRGPRGLSSFVRESRRHPRPALTASPLPAKSPVNGSLCEPRSPLGG
PDPAELLLMGSYLGKPGPPEPALPQDPRDRPGRRPPSRSPPSSSTAQRVHHVYPALPTPL
LRPSRRPPHRDCGPLSSRFVITPRRRYPIQQAQYSLLGALPTVCWNGGHKKAVLSARNSR
MVCSPVTVRIAPPDSKLFRSPMPEQILSTTLSSPSSNAPDPCAKETVLNALKEKKKRTVA
EEDQLHLDGQENKRRRHDSSGSGHSAFEPLVANGVPAAFVPKPGSLKRSLASQSSDDHLN
KRSRTSSVSSLTSTCTGGIPSSSRNAITSSYSSTRGVSQLWKRSGPTSSPFSSPASSRSQ
TPERPAKKTREEEPCHQSSSSAPLVTDKESPGEKVTDPATGKQQSLWTSPPTPGSSGQRK
RKIQLLPSRRGDQLTLPPPPELGYSITAEDLDMERRASLQWFNKVLEDKTDDASTPATDT
SPATSPPFTLTLPTVGPAASPASLPAPSSNPLLESLKKMQESPAPSSSEPPEAATVAAPS
PPKTPSLLAPLVSPLTGPLASTSSDSKPTTTFLGLASASSATPLTDTKAPGVSQAQLCVS
TPAATAPSPTPASTLFGMLSPPASSSSLATPGPACASPMFKPIFPATPKSESDNPLPTSS
SAATTTPASTALPTTATATAHTFKPIFESVEPFAAMPLSPPFSLKQTTAPATTAATSAPL
LTGLGTATSTVATGTTASASKPVFGFGVTTAASTASTIASTSQSILFGGAPPVTASSSAP
ALASIFQFGKPLAPAASVAGTSFSQSLASSAQTAASNSSGGFSGFGGTLTTSTSAPATTS
QPTLTFSNTVTPTFNIPFSASAKPALPTYPGANSQPTFGATDGATKPALAPSFGSSFTFG
NSVASAPSAAPAPAAFGGAAQPAFGGLKASASTFGTPASTQPAFGSTTSVFSFGSATTSG
FGAAAATTQTTHSGSSSSLFGSSTPSPFTFGGSAAPAGGGGFGLSATPGTGSTSGTFSFG
SGQSGTTGTTTSFGGSLSQNTLGAPSQSSPFAFSVGSTPESKPVFGGTSTPTFGQSAPAP
GVGTTGSSLSFGAPSTPAQGFVGVGPFGSGAPSFSIGAGSKTPGARQRLQARRQHTRKK
NT seq 3600 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcggctgcggcggctgacggaggcgagcggcggcggcctccgttgggcgta
cgggaaggccggggccggacccgcggctgcggaggaccagcgggtgccgcggcactgggc
ctagcgctgctcggcctcgcgctctacctagtgcccgcggcggccgcgctggcctggctg
gccgtgggggcgagcgcggcctggtggggcctgagccgagaaccccgcggcccgaggggc
ctgtcgtcgttcgtgcgcgagtcgcgccgtcacccgcggcccgcgctcaccgcttcaccg
cttccagccaagtcgccagtcaacggtagcctctgcgaaccccgcagcccgcttggaggc
cccgaccccgctgaactcttactcatgggcagctacctgggcaagccaggcccgccggag
cctgccctcccgcaggaccctagagacaggccagggcgccgcccaccctcacggtccccg
ccgtcgtcttcgacggcccagcgagtccaccacgtctaccccgcgctccccaccccactt
ttgcgaccttctcggaggccgccccaccgagattgtgggcctttatccagtcggtttgtt
ataacaccccgaagacgatatcccattcagcaagcccagtattccttgctgggggcactt
ccaaccgtatgctggaatggtggccataagaaagccgtgctatctgcacggaactcgagg
atggtgtgcagcccagtgacagtgaggattgcccctccagacagcaagctatttcgatca
ccaatgccggagcagatactcagcaccacactgtcttcaccatcaagtaatgccccagac
ccttgtgcaaaggagacggtgctgaatgccctcaaggaaaagaagaaaaggacagtggca
gaggaagaccagctgcatcttgatggccaggaaaacaagagaagacgccacgatagcagt
gggagtggacattcggcattcgagccccttgtggccaacggagtccctgctgcatttgtg
cctaagcctggctccctgaagagaagtctggcttcccagagctcggatgaccacttgaac
aaacggtctcgcacctcctctgtgagctccctgactagcacatgcacaggaggcatcccc
agctccagccgcaacgccatcaccagctcctacagctccacccgaggtgtctcacagctg
tggaagaggagtggtcccacctcttctcccttctccagcccagcttcctcccgctcccag
acaccagagaggccagccaagaagacaagagaggaggaaccatgtcaccagtccagttct
tcagctcccttggtgacagacaaggagtccccaggagaaaaggttacagatccagccacg
gggaagcagcagagcctgtggacttccccacccacacctggcagctccgggcaacgcaaa
cgcaagattcagctgctgccctcccggcgaggggaccagctcaccttgcctccaccccct
gagcttggctattccatcactgctgaagacctggacatggagaggagagcctcactgcag
tggtttaacaaggtcttggaggataagacggatgatgcctctaccccagccactgacacc
tccccagccaccagccctcccttcacactcaccctgcctaccgtggggcctgctgcctca
ccagcctccctcccagctcccagctctaacccactgttggagagtttgaagaagatgcag
gagtctccagccccatcctcctcagaacctcctgaggcagcaacagttgcggccccttca
cctccgaagacacctagcctcctggcccctcttgtctcaccactgacagggcccctagcc
agcacctcctcagactccaaacctacaaccaccttcctggggctggcttctgcttcatcc
gccacaccactcactgacaccaaggcccctggagtctctcaggcccagctgtgtgtcagc
accccagccgccacagctccctccccaactccagccagcacgctgtttgggatgctgagt
ccacctgccagctcctcttcccttgccactcctggcccagcttgcgcttctcccatgttt
aagcccattttcccggccacacctaagagtgagagtgataatcccttgccaactagctcc
tcagccgccacgacaactccagccagcaccgccctccccacaacagcaaccgccacagct
cacactttcaagcccatttttgagagcgtggagccatttgcagccatgcccctgtcacct
cccttctccctgaagcagacaactgctccagccaccactgcagccacatcagctcctctc
ctcactggcctgggcactgccacttccacagtggccactggcaccacagcttctgcctcc
aagcctgtgtttggctttggagtgaccactgcagcgagcactgccagtaccatagcttcc
acctcccagtcaattctgtttgggggagccccgcctgttactgcttccagttccgcccca
gccctggcctccatcttccaatttggcaagccccttgccccagcagcgtctgtggcgggc
acctcctttagccagtcccttgccagctctgcccagactgctgccagcaatagtagtggg
ggcttcagtggttttggtgggaccctcaccacctccacctctgcccctgccaccaccagc
cagcccactctgaccttcagcaacactgtcacccccaccttcaacattccctttagcgcc
agtgccaagcctgcgctcccaacctaccccggagccaactcacagcccacatttggagcc
actgatggggccaccaagccggcacttgccccaagttttggcagctctttcacttttggc
aactctgtggcctcagccccgtcggcagccccagcaccagccgcctttggtggtgctgca
cagccagctttcggagggttgaaagcctcagcctccaccttcggcacccctgccagcact
cagccggctttcggtagcaccacctccgtgttctcctttggttcagccaccacatctggc
tttggtgctgctgccgccaccacacagaccacccacagtgggagcagcagctctctgttt
ggcagctctactccatccccattcacattcggtggctcagcagctcctgctggtggtgga
ggctttgggcttagtgctacaccaggtaccggctccacctctggaacttttagctttgga
tctggacagagcgggaccacgggcaccaccacctcctttgggggaagtctgagtcagaac
accctgggcgcacctagccagagctcaccgttcgccttcagtgtgggcagtacacctgaa
agcaagcctgtgtttggaggcacatccacacctacttttgggcagagtgcccctgcccca
ggagtcggcaccacaggcagcagcctctcatttggggccccttcaacacctgcccaaggc
tttgttggagttggacctttcggatcaggagccccttccttttccattggcgcgggatcc
aagaccccaggggctcgacagcgacttcaggcccgaaggcagcacacccgcaagaagtag

DBGET integrated database retrieval system