KEGG   Rattus norvegicus (rat): 114027Help
Entry
114027            CDS       T01003                                 

Gene name
Dao, Dao1
Definition
D-amino-acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    114027 (Dao)
   00330 Arginine and proline metabolism
    114027 (Dao)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    114027 (Dao)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    114027 (Dao)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    114027 (Dao)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     114027 (Dao)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
12q16
AA seq 346 aa AA seqDB search
MRVAVIGAGVIGLSTALCIHERYHPAQPLHMKIYADRFTPFTTSDVAAGLWQPYLSDPSN
PQEAEWNQQTFDHLQSCLHSPNAEKMGLALISGYNLFRDEVPDPFWKSTVLGFRKLTPSE
LDMFPDYSYGWFNTSLLLEGKSYLSWLTERLTERGVKFIHRKVASFEEVVRGGVDVIINC
TGVWAGALQADASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSKTVTLGGV
FQLGNWSELNSVHDHNTIWKSCCQLEPTLKNARIMGELTGFRPVRPQVRLERERLRFGSS
SAEVIHNYGHGGYGLTIHWGCAMEAANLFGKILEEKNLSRMPPSHL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtggccgtgattggagcgggagtcatcggactgtctacagccctctgcattcat
gaacgttaccacccagcccaacctctgcacatgaagatctatgcggatcgcttcacgccg
ttcactaccagcgatgtggctgcgggactctggcagccttatctctctgaccccagcaac
ccgcaggaggcggagtggaaccagcaaactttcgatcaccttcagagctgcctccattct
ccaaacgctgagaaaatgggcttggccctaatctcaggctacaacctcttccgagacgaa
gtcccggaccctttctggaaaagcacagttctgggattccggaagctgacccccagcgag
ttggacatgttccctgattatagctatggctggttcaacacgagcctccttcttgagggg
aagagctacctatcatggctgactgagaggttaactgagaggggagtgaagttcatccat
cggaaggtggcatctttcgaagaggtggtgagaggaggcgtggatgtgattatcaactgc
accggggtgtgggccggggctctgcaagcagacgcctccctgcagccaggccggggccag
atcatccaggtggaggccccttggataaagcacttcatcctcacccatgatcccagcctt
ggcatctacaactctccatacatcatcccaggttccaagacagttacactcggaggtgta
ttccagctggggaactggagcgagctaaacagcgtccatgaccacaacaccatttggaag
agctgctgtcaactggagcccaccctgaagaatgcaagaatcatgggtgaactcactggc
ttccggccagtccgacctcaggtccggctagaaagagaacgccttcgctttggatcttca
agtgcagaggtcatccataactatggtcatggaggttacgggctcacgattcactggggt
tgtgcaatggaggcagccaacctctttgggaaaattctagaagaaaagaacttgtccagg
atgcctccatcccacctctga

DBGET integrated database retrieval system