KEGG   Rattus norvegicus (rat): 114106Help
Entry
114106            CDS       T01003                                 

Gene name
Bcmo1, Bcdo
Definition
beta-carotene 15,15'-monooxygenase 1 (EC:1.14.99.36)
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
rno  Rattus norvegicus (rat)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    114106 (Bcmo1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.36  beta-carotene 15,15'-monooxygenase
     114106 (Bcmo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
19q12
AA seq 566 aa AA seqDB search
MEIIFGRNKKEQLEPLRATVTGSIPAWLQGTLLRNGPGMHTVGDSKYNHWFDGLALLHSF
SIRDGEVFYRSKYLQSDTYNANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATTETNYIRKIDPQTLETLEKVDYRKYVAVNLATSHPHYDEAGN
VLNMGTSIADKGRTKYVMFKIPATAPGSKKKGKNPLKHSEVFCSIPSRSLLSPSYYHSFG
VTENYVVFLEQPFKLDILKMATAYMRGVSWASCMTFCKEDKTYIHIIDQKTRKPVPTKFY
TDPMVVFHHVNAYEEDGCVLFDVIAYEDNSLYQLFYLANLNKDFEEKSRLTSVPTLRRFA
VPLHVDKDAEVGSNLVKVSSTTATALKEKDDHVYCQPEVLYEGLELPRINYAHNGKPYRY
IFAAEVQWSPVPTKILKYDVLTKSSLKWSEESCWPAEPLFVPTPGAKDEDDGVILSAIIS
TDPQKLPFLLILDAKSFTELARASVDVDMHLDLHGLFIPDAGWNAVKQTPAKTQEDENSD
HPTGLTAPGLGHGENDFTAGHGGKSL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggagataatatttggccggaataagaaagaacagctggagccattacgggccacagtg
acaggcagcattccagcatggctgcaggggaccctgctccgaaacgggcctgggatgcac
acagtgggagacagcaagtacaaccattggtttgatggcctggcccttctccacagtttc
tccatcagagatggggaggtcttctacaggagcaaatacctgcagagcgacacctacaac
gccaacatcgaggccaatagaatcgtggtgtctgagttcggaacaatggcctacccagac
ccctgcaaaaacatcttttccaaagctttctcctacttgtcccacaccatccccgacttc
acagacaactgcctgattaacatcatgaaatgtggagaagacttctatgccaccacagag
accaactacatcaggaaaatcgacccccagactctagagaccttggagaaggttgattac
cggaagtatgtggctgtaaacctggctacctcacaccctcattacgacgaggctggaaat
gtccttaacatgggtacctccatcgcggacaaaggaaggacaaaatacgtgatgtttaag
atccccgccacagcaccaggcagcaagaagaaagggaagaaccccttgaagcactcagaa
gttttctgctccatcccgtcccgctcgctgctctcccccagttactaccacagctttgga
gtcacggagaactatgtggtgtttctggagcagccttttaagctggatatcctcaagatg
gccaccgcatacatgaggggtgtgagctgggcttcctgtatgacattctgcaaggaggac
aagacttacattcatatcatcgaccagaagaccagaaagcctgtgccaaccaaattctac
acagaccccatggtggtcttccaccatgttaatgcctatgaggaggacggctgtgtgctg
tttgatgtcatcgcctatgaggacaacagtctctatcagctcttctacctggccaacctg
aacaaggacttcgaggagaagtccaggctgacctcagtgcctaccctcaggaggtttgct
gtgcccctccacgtggacaaggatgcagaagtgggctcgaatttagtcaaggtgtcatct
acaacagcaactgccctgaaggagaaggacgaccatgtctactgccagcctgaggtcctc
tacgaaggcctagagctccctcggataaattatgctcacaacgggaagccatatcgctac
atctttgctgctgaagtacaatggagtccagtcccaaccaagatactaaaatatgacgtt
ctcaccaagtcctccttaaagtggtccgaggagagctgctggcctgcagagcctctgttt
gtccccacaccgggtgcgaaggatgaggatgatggagtcatcttatcagccatcatctct
acagatccccaaaagctgccctttttacttattctggatgcgaaaagttttacggaattg
gctcgcgcctctgttgatgtggacatgcacctggacctgcatggtttatttattccggat
gcaggctggaatgcagtgaagcagactccagccaaaacgcaagaggatgaaaattcagat
catcccacaggtctgacagcaccaggattgggccatggtgaaaatgacttcacggcaggt
catggcggcaagagcctttaa

DBGET integrated database retrieval system