KEGG   Rattus norvegicus (rat): 114207Help
Entry
114207            CDS       T01003                                 

Gene name
Ryr1, RYR-1, Ryr1l
Definition
(RefSeq) ryanodine receptor 1
  KO
K04961  
ryanodine receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Calcium signaling pathway
Circadian entrainment
Long-term depression
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    114207 (Ryr1)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    114207 (Ryr1)
  Nervous system
   04730 Long-term depression
    114207 (Ryr1)
  Environmental adaptation
   04713 Circadian entrainment
    114207 (Ryr1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114207 (Ryr1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114207 (Ryr1)
Ion channels [BR:rno04040]
 Ryanodine and IP3 receptors
  Ryanodine receptor (RYR)
   114207 (Ryr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
1q21
AA seq 4344 aa AA seqDB search
MGDGGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVP
PDLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLS
CLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERY
LHLSTASGELQVDASFMQTLWNMNPICSCCEEGFVTGGHVLRLFHGHMDECLTISPSDSD
DQRRLVYYEGGPVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALTEDQGL
VVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTY
AAPDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLD
SFSGKPRGSGPPAGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQ
EEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCAL
FSTNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKV
LDVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQY
GKWYFEVMVDEVAPFLTAQATHLRVGWALSEGYSPYPGGGEGWGGNGVGDDLYSYGFDGL
HLWTGHVARPVTSPGQHLLGPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFP
VVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLQPIKEYRREGPRGPHL
VGPSRCLSHLDFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDD
NKRLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTY
MMNNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNP
RLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQSRGDRARIFRAEK
SYAVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADDLAYVFNGHRGQRWHLGSEPF
GRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQV
GHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEPVPLEHPHYEVAR
MDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLASPGLQPPA
EDEARAAEPDTDYENLRRSAGGWGEAEAGKDGTAKEGTPGGAAQPGVEAQPARAENEKDA
TTEKNKKRGFLFKAKKVAMMTQPPSTPALPRLPRDVVPADNRDDPEIILNTTTYYYSVRV
FAGQEPSCVWVGWVTPDYHQHDMSFDLSKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGD
FVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQ
NVVQFELGKQKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLHVDTRR
AGERLGWAVQCQEPLMMMALHIPEENRCMDILELSERLDLQRFHSHTLSLYRSVCALGNN
RVAHALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLT
EETRAITLFPPGRSAEDGPRRHGLPGVGVTTSLRPPHHFSPPCFVVALPAAGAAEAPARL
SPAIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFSDED
VKQILKMIEPEVFTEEEEVEEEEEEEEEDEEEKEEDEEEEAHEKEDEEKEEAEEAAEEEK
EELEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQSNQRGRYGL
LMKAFTMSAAETARRTREFRSPPQEQINMLLQFKNGADEEDCPLPEEIREDLVNFHQDLL
AHCGIQLEGEEEEPEEESTLGSRLMSLLEKVRLVKKKEEKPEEEPAAEEHKPQSLQELVS
HTVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISLSSVEDTMSLLECL
GQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGE
SKEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAAS
VIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAV
FVNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRR
DRRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRS
LVPLDDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLL
HVLDVGFLPDMRAAASLDTVSIPTGLPPRRWALALNRYLCLAVLPLITKCAPLLRGTEHR
AIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNE
FAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQEL
YRIAMPCLCAIAGALPPDYVDASYSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFI
NKFAEYAHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKA
MIAWEWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMA
EQLAENYHNTWGRKKKQELEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGY
AVTRGLKDMELDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEI
KFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVS
LFGTDAPAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKV
SQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSL
GTTRNPYVEKLRPALGECLARLAAAMPVAFLEPELNEYNACSVYTTKSPRERAILGLPNS
VEEMCPDIPVLERLMAEIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPA
LPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLR
SHFIPTIGRLRKRAGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRY
VDNNRAHWLTXAQSQLGKLFRMVGEIFIYWSSPHGDPKPCCGTSHSCHSSHGTLSLNQSR
ARRRLLPVQGSEPPLLPHQNLSVKMAKAGDVQSGGSDQERTKKKRRGDRYSVQTSLIVAT
LKKMLPIGLNMCAPTDQDLIVLAKARYALKDTDEEVREFLQNNLNLQGKVEGSPSLRWQM
ALYRGVPGREEDADDPEKIVRRVQEVSAVLYHLDQTEHPYKSKKAVWHKLLSKQRRRAVV
ACFRMTPLYNLPTHRACNMFLESYKASWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEK
KPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENVEEGGEEEEVEV
SFEEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGAMVSSTLKLGISILNGGNAE
VQQKMLDYLKDKKEVGFFQSIQALMQTCRWARCHQVPLSDLPLTSFQVSDSPPGEDDIEG
SGAGDMFRGSGLVIGSGWGSRASEEVEGDEDENMVYYFLEGGTGYMEPALRCLSLLHTRW
PFSCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPS
NYWDKFVKRKVLDKHGDIFGRERIAELLGMDLASLEITAHNERKPDPPPGLLTWIMSIDV
KYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHN
GKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRA
GGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKED
METKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKM
YQERCWDFFPAGDCFRKQYEDQLG
NT seq 13035 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatggaggaggtgaaggcgaggacgaggtccagtttttgcggacggacgacgaa
gtggtcctgcagtgcagcgccaccgtgctcaaggagcagctcaagttgtgtctggccgct
gagggtttcggtaatcgcctctgcttcctcgaacccaccagcaacgcgcagaatgtaccc
cctgatctggccatctgctgctttatcctggagcagtctctgtcagttcgagccctgcag
gagatgctggccaatactgtggaggccggtgtagagtcatcccagggcgggggacacagg
acactcttgtatggccatgccatcctgctccggcacgcacacagccgtatgtacctgagt
tgcctcaccacctcccgatccatgactgacaagttggcctttgatgtgggattacaggaa
gacgccacaggggaggcctgttggtggacgatgcacccagcctcgaagcagaggtctgaa
ggagagaaggttcgagttggggatgacctcatccttgtgagtgtctcctctgagcgatac
ctgcacctgtcaaccgcaagtggggaactccaggtggatgcctccttcatgcagactctg
tggaatatgaaccctatctgctcctgctgtgaagaaggctttgtgactggaggacatgtc
ctccgcctctttcatggacatatggatgaatgtctgaccatttccccttctgacagtgat
gaccaacgcagacttgtctactacgagggagggcctgtgtgcacccatgcccgctccctg
tggaggctggagccactgagaatcagctggagtggaagccatctccgctggggccagcca
ctaagaatcaggcatgtgaccacagggaggtaccttgcgctcactgaggaccaaggcctt
gtggtggttgatgccagcaaggcccacaccaaggccacttccttttgcttccgcatctcc
aaggagaagctggatgtggcccccaagagagatgtggagggcatggggccccctgagatc
aagtatggagagtcactctgctttgtgcagcatgtggcctcaggtctgtggctcacctat
gcggccccagaccccaaggccctgaggcttggggtactcaagaagaaggccatgctgcac
caggaaggccacatggatgatgcgctatcactgacgcgatgccagcaggaggagtcccag
gctgcccggatgatatacagcactgcgggcctgtacaaccagttcataaagggtctcgat
agcttcagcgggaagccacggggttcggggccaccggctgggtcagcactgcccatcgag
ggcgtcatcctgagcctacaagacctcatcggctatttcgagccgccttcggaggagctg
cagcacgaggagaagcagaccaagctccgcagcctgcgcaaccgacaaagcctcttccag
gaggaggggatgctctccctggtcctgaattgcattgatcgcctcaatgtctacaccacc
gcagcccattttgctgaatttgcaggggaggaggcagctgaatcctggaaagagattgtg
aacctgctctatgaacttctagcttctctgatccgtggcaatcgcaccaactgtgccctc
ttttccacaaacttggattggctggtcagcaaactggatcgtctggaggcctcatctggc
atcctggaggtgttgtactgtgttctgattgagagtcctgaggtgctaaacatcatccag
gagaaccacatcaagtctatcatctccctcttagacaagcatgggaggaatcacaaggtc
ctggatgtgctatgctcactctgtgtgtgcaatggtgtagctgtgcgctccaaccaggat
ctcattactgagaacttgctcccgggccgtgaacttctgctgcagacaaaccttatcaac
tacgtcaccagcatccgtcccaacatctttgtgggccgagcagagggctccacgcagtat
ggcaagtggtacttcgaggtgatggtggacgaggtggctccgtttctgacagctcaggcc
acccacctgcgggtgggctgggccctcagcgagggctacagtccctaccctggaggtggc
gagggctggggcggcaacggggtcggcgatgacctctattcttacggctttgatgggctg
cacctctggacagggcatgtggcacgcccagtgacttctcccggacaacacctcttgggc
ccggaggatgtggtcagctgctgcctggacctcagcgtaccatccatctcctttcgtatc
aatggctgccccgtgcagggtgtctttgaatccttcaacctcgatgggctctttttcccc
gtcgtgagcttctccgctggtatcaaagtgcgcttcctccttggcgggcgccacggtgaa
tttaagttcctgcccccacctggctatgccccatgccatgaagctgtgcttcctcgggag
cggctccatctccaaccaatcaaagagtatcgcagggaagggcctcgggggccccacctg
gtgggccccagtcgctgcctctcacatctggactttgtgccctgccctgtggacaccatc
cagatcgtcttgcccccccacctggagcgaattcgggagaagctggcagagaacattcat
gaactctgggcactgactcgcattgagcagggatggacctatggtccggttcgggatgac
aacaagaggctgcacccatgtcttgtggattttcacagcttgccagagcctgagcggaat
tacaacttgcagatgtcaggggagacactcaagactctgctggccctgggctgccatgtc
ggcatggcagatgagaaggcagaggacaacctgaagaagacgaagctccctaagacgtat
atgatgaacaacggatataagccggctcctctggacctgagccacgtgaggctgacgcct
gcgcagacgactctggtggaccggctggcagagaacgggcacaatgtatgggcgagagac
cgggtggcacagggctggagctatagcgctgtgcaggacatccctgcacgcagaaaccct
cgcctcgtgccctaccgcctgcttgacgaggccaccaagcgcagcaaccgggacagcctc
tgccaggctgtgcgcacactcttgggctatggctacaacatcgagccacctgaccaggag
cccagtcaggtggacagccagtctcgaggcgaccgggcccgcatcttccgggcggagaag
tcctatgcagtccagagcggccgctggtacttcgagtttgaagcagtcaccacaggagag
atgcgagtggggtgggcaagacctgagctgagacctgacgtggagctgggggctgatgat
ctggcctatgtcttcaatgggcaccgaggccagcgctggcacttgggcagtgagccattc
ggacgtccctggcagtcgggtgatgtcgttggctgcatgattgatctcacggagaacacc
atcatcttcaccctcaatggcgaggtcctcatgtctgactcgggctcggaaacagccttc
cgagaaattgagattggggacggcttcctgccagtctgcagcttgggacctggtcaggtg
ggccacctgaacctgggccaggatgtgagctccctgaggttttttgccatctgtggcctc
caggaaggctttgagccgttcgccatcaacatgcaacgcccagtgaccacctggtttagc
aagagccttcctcagtttgagcctgtgcccctcgaacacccccactatgaggtggcccgc
atggatggcactgtggatacacctccctgcctgcgcttgactcaccgtacctggggctca
cagaacagtctggtggagatgctgtttctccggctaagccttccggtccagttccaccag
cacttccgctgcaccgcaggggccacacccctcgcatcccctggcctgcagccgcctgcg
gaagatgaggcccgggcagcagaaccggatacggactatgagaacctgcgccgctctgct
ggaggctggggagaggctgaggcgggcaaggatggaactgccaaggaggggacacccgga
ggcgctgcccagccaggggtagaggctcagcctgcaagggcggagaatgagaaagacgcc
accacggagaagaacaagaagagagggttcttattcaaggccaagaaggttgccatgatg
acccaaccaccttccaccccggctcttccccgactccctcgagatgtagtacctgctgac
aaccgtgacgaccctgagatcatcctcaacaccaccacgtactattactctgtgagggtc
ttcgcgggtcaggagcccagctgcgtgtgggtgggctgggtcactcctgactaccatcaa
catgacatgagcttcgacctcagcaaggtccgggcggtgacagtgaccatgggggatgaa
caaggcaatgtccacagcagcctcaagtgtagcaactgttacatggtgtggggcggggat
ttcgtgagtccgggacagcaaggccgcatcagccacacggacctagtcattggatgcctg
gtggatctggccaccggcttgatgacctttacagccaatggcaaagaaagcaacaccttc
ttccaggtggagcccaacacaaagctgtttcctgccgtctttgtcctgcccacccaccag
aacgtggtccagtttgagttggggaagcaaaagaacatcatgccgctgtcagccgccatg
ttcctcagcgagcgcaagaatccagccccgcagtgcccaccaaggctggaggtgcagatg
ctgatgcctgtctcctggagccgaatgcccaaccacttcctacatgtggacacgcggcgt
gctggcgagcggctgggctgggctgtgcagtgccaggagccgctgatgatgatggcgcta
cacatcccggaggagaacaggtgcatggacatcctggagctgtctgagcggctggatcta
cagcgcttccactcgcacacgctctcgctctaccgctccgtgtgcgccctgggcaacaac
cgcgtggctcatgccctgtgcagccacgtggaccaggcacagctgctgcatgctctggaa
gacgcgcacttgccgggtcctctgcgtgcaggctactatgacctcctcatcagcatccac
ctcgaaagcgcctgccgcagccgtcgctccatgctctctgagtacattgtgccgctcaca
gaggagacccgagccatcacgcttttcccacccggtcgtagcgcggaagatggcccccgc
cgccatggcctgcctggcgttggggtcacaacctccctgagacctccacaccacttctca
cccccgtgttttgtggtcgccctgccagctgctggggccgcagaagctccggctcgcctc
agccctgccatccctctggaggctctgcgagacaaggcgctgagaatgttgggggaagcc
gtgcgtgacggaggacagcatgctcgcgacccagtagggggctctgtggagttccagttt
gtgccggtgctcaagcttgtgtctaccctcctggtgatgggtgtctttagcgacgaggat
gtgaagcagatcctgaagatgatagagcctgaagtcttcaccgaggaagaagaggtggag
gaggaggaagaggaggaagaggaagatgaggaggagaaagaggaggacgaggaggaagag
gcacacgagaaggaagatgaggaaaaagaagaggcagaggaggccgcagaggaggagaag
gaagagctggaggaggggctgctgcagatgaagttgcctgagtctgtgaaattacagatg
tgccacctcctggagtatttctgtgaccaagagctgcagcaccgggtggagtccttggca
gcctttgcggagcgatatgtggacaagctgcagagcaatcagcggggtcgctacggcctc
ctcatgaaagccttcaccatgagcgcggccgagactgcaaggcgcacgcgggagttccgc
tctccgccccaagagcagatcaacatgctattgcaattcaaaaatggtgccgatgaggaa
gattgtcctctccctgaagagatccgagaggatttagttaactttcaccaagacctgttg
gcacattgtggaatccagctggagggagaggaggaggagccagaggaagagagcactctg
ggcagccgcctcatgagcctgttggagaaggtgcggctggtgaagaagaaagaggagaag
cctgaggaggagccggcagctgaggagcacaagcctcagtccttgcaggagctggtgtcg
cacacagtggtgcgctgggcccaggaggacttcgttcagagcccagagctggtccgagcc
atgttcagcctcctgcaccggcagtacgatggactcggcgagctgctgcgtgccctgcct
cgggcctacacgatctctctgtcctcagtggaggacaccatgagcctgctggagtgtctg
ggccagatacgctcactgcttattgtgcagatgggtccccaggaggagaacctcatgatc
cagagcattgggaacatcatgaataacaaagtcttctaccagcacccaaacctgatgaga
gcgctcggtatgcacgaaactgtcatggaggtcatggtgaatgtcctcgggggcggcgag
tcaaaggagatccgcttccccaagatggtgacaagctgctgccgtttcctctgctacttc
tgccggatcagccggcagaaccagcgctctatgtttgaccacctgagctacctgctggag
aacagtggcattggcctggggatgcagggctccacgcccctggatgtagcagctgcttct
gtcattgacaacaatgagctggccttggcattacaggagcaagacctggaaaaggttgtg
tcatacttggcagggtgtggcttacaaagctgccccatgctcctggccaaaggctatcct
gacatcggatggaatccctgtgggggcgagcgctacctggacttcctgcgctttgccgtc
tttgtcaacggtgagagcgtggaagagaacgctaatgtggtagtgcggctgttgatccga
aagcccgagtgctttggacctgccctgcggggtgagggtggctcagggctgctggctgcc
atcgaagaagccatccgcatctccgaggaccctgcacgggatgggccgggtgtccgcagg
gaccggcgacgtgagcactttggtgaggaaccccctgaagagaaccgggtacatctagga
cacgccatcatgtccttctatgctgctttgattgacctgctgggacgctgtgctcctgag
atgcatctgattcaagccggtaagggtgaggccctgaggatccgtgctatccttcggtcc
ctcgtgcctttggatgaccttgtgggcatcatcagcctcccactgcagatccccaccctg
ggcaaagatggcgcactggttcagccaaagatgtctgcatccttcgtgcctgaccacaag
gcatccatggtgcttttcctggaccgagtgtatggcattgagaaccaggacttcttgctg
catgtgctggatgtggggttccttcctgacatgagggcagctgcctcactggacacggtg
agcatccccaccgggctaccaccccggagatgggcgctggcacttaaccgctacttgtgc
ctggctgtgctgccgctcatcaccaagtgcgcgccactcttgcggggcaccgagcaccgc
gccatcatggtggactccatgctgcacacagtataccgactgtcgcggggccgctcgctc
accaaagcacagcgcgacgtcattgaggactgcctcatggcgctgtgcaggtatatccgc
ccgtccatgctgcagcacctgcttcgacgcctggtgttcgatgtgcccatcctcaatgag
tttgccaagatgcctctcaagctccttaccaaccactacgagcgttgctggaagtactac
tgccttcccacaggctgggccaacttcggggtcacctctgaggaagagctgcacctcaca
cgcaagctcttctggggcatctttgattctctggcgcataagaaatacgaccaggagctt
taccgaatagccatgccgtgtctctgtgccattgcgggggcactgccccccgactatgtg
gatgcctcatactcctccaagacggagaaaaaagccacagtggatgcggaaggcaacttt
gatccccggcctgtggagaccctcaatgtcatcatcccagagaagctggactccttcatt
aacaagttcgcagaatatgcccatgagaagtgggcctttgacaagattcagaacaactgg
tcctatggcgagaacattgatgaagaactgaagacccaccccatgctgagaccctacaag
accttctcagagaaggacaaagagatttaccgctggcccatcaaggagtccttgaaggcc
atgattgcctgggaatggacggtcgagaaggccagggaaggtgaggaggaaaagaccgaa
aagaaaaaaacaagaaagatatcccaaacggcccagacatatgaccctcgagaaggctac
aatccccagccaccagacctcagtgtggttacgttgtcccgggagctgcaggccatggct
gaacaattggcagagaattatcacaacacttgggggcgaaagaagaagcaagagctggag
gctaaagggggtgggtcccatcctctgctggtcccctacgacacgcttacggccaaggag
aaggcgcgggaccgggagaaggcccaggagttgctgaagtttctgcagatgaatggctat
gctgtcaccaggggtcttaaggacatggaactggacacatcttccattgagaaacgattt
gcctttggcttcctgcagcagctgctgcgctggatggacatctcccaggagtttatcgcc
cacttggaggctgtggtcagcagtggacgggtagagaaatccccacatgaacaggagatt
aaattctttgctaagattctgctgcctttaatcaaccaatacttcaccaaccactgtctc
tacttcctatccacaccggccaaagtgctgggcagtggtggccatgcctccaacaaggag
aaggaaatgatcaccagcctcttctgtaaacttgctgctcttgtccgccaccgagtctcc
ctctttgggacggatgccccagctgtggtcaactgtcttcatatattggcacgttccctg
gatgccaggacggtgatgaaatcgggccctgagatcgtaaaggcgggtctgcgctccttc
ttcgagagtgcctcggaggacattgagaagatggtggagaacctgcggctaggcaaggtg
tcccaggcacgcacgcaggtgaagggtgtgggccagaacctcacctacaccacagtggct
ctgctgcctgtcctcaccaccctcttccagcacatcgcccagcaccagttcggagatgat
gtcatcctggatgacgttcaagtttcttgctaccgaacactatgcagtatctactctctg
ggaaccaccaggaacccctacgtggaaaagctgcggccagccctgggggaatgcctggcc
cgcctggccgcagccatgccagtggcattcctggagcctgagctgaatgaatacaacgcc
tgctctgtctacaccaccaagtctcctcgagagcgggccatcctggggcttcccaacagt
gtggaagagatgtgtccagacatcccggtgctagaacggcttatggcagagatcgggggg
ctggccgagtccggggcgcgctacaccgagatgccgcacgtcatcgagatcacactgcct
atgctgtgcagctacctgccccgctggtgggagcgagggcctgaggcgcccccaccagcc
ctgcctgcaggagccccaccaccctgtacagccgtcacctccgatcacctcaattcccta
ctggggaacatccttcgaatcatcgtcaataacctgggcatcgatgaggcctcgtggatg
aagcggttggctgtgtttgcccagcccatcgtgagccgtgccaggccagagctcctacgc
tcccacttcatccctactatcgggcgactgcgtaagcgggcagggaaggtggtggctgag
gaggagcagctgcgcctggaggccaaggcagaggctgaggagggtgagctcctggtccgg
gatgagttctccgtgctctgccgtgacctgtatgccctctacccactgctcatccgctac
gtagacaacaacagggcacactggctgacatgagcccaatcccaactcgggaagctgttc
aggatggtgggagaaatcttcatctactggtcaagtccccacggtgatcccaaaccctgt
tgtggaacctcccactcatgtcacagctctcacggtacactctccttaaaccagagcagg
gcacgtaggcgccttctgccggttcaggggtctgagccaccgctgcttccccaccagaat
ttaagcgtcaaaatggccaaggcaggagacgtacagtcaggtggctcggaccaggaacgc
accaagaagaaacgccggggggaccgctactcggtgcagacatccttgatcgtggccacg
ctcaagaagatgttaccgataggactaaacatgtgtgctcccactgaccaggacctcatt
gtgctggccaaggcccgctatgcgctgaaagatacagatgaggaggttcgtgaattcctt
caaaacaaccttaaccttcagggaaaggtggaaggctcaccatctcttcgctggcaaatg
gcactgtaccgcggcgttccaggccgcgaggaagatgccgatgatcctgagaaaatcgtg
cgcagagtccaggaagtgtccgctgtgctctatcacctagaccagacggagcatccttac
aagtccaagaaggcggtgtggcataaacttttgtccaagcaacgccggagggcagtggtg
gcctgtttccgcatgacgcccctatacaacttacccacgcaccgagcatgcaacatgttc
ttggagagctacaaagcctcctggatcctgactgaggaccacagtttcgaggaccgcatg
atagatgacctatcaaaagctggggagcaggaggaagaggaggaagaagtggaggagaag
aagccagaccccctacaccagttggtcctacacttcagccggacagctctgactgaaaag
agcaaactggatgaggactacctgtacatggcttacgctgacatcatggcaaagagctgc
cacctggaggagggcggggaaaatgtcgaagaaggaggtgaagaagaggaagtggaggtg
tcctttgaggagaaggagatggagaagcagaggctcctgtaccagcagtcgaggctgcac
aaccggggtgccgccgagatggtactgcagatgatcagtgcttgcaaaggagagacgggt
gccatggtgtcttccaccctgaagctgggcatctccatcctcaacggagggaacgctgaa
gtgcagcagaaaatgctggattacctgaaggacaagaaggaagtgggcttcttccagagt
atccaggcgctaatgcaaacgtgcaggtgggccaggtgccaccaggtccccctttctgat
ttgcctttgacctcatttcaggtttcagactctccgccaggggaggatgacatagaaggt
tccggagctggggacatgttcaggggcagtggtctggtgattggctctggctggggctcc
agagccagcgaggaggtagagggtgatgaagatgagaacatggtgtactacttcctggag
ggaggcaccggctacatggaacctgccctgaggtgcttgagcctgctgcatacccggtgg
cctttctcgtgcatcattggctacaactgtctcaaggtgccccttgtgatctttaagagg
gagaaggagctggcccggaagctggagttcgatggtctctacattacagagcagccagag
gatgatgatgtgaagggacagtgggatcgcctggtgctcaacacaccgtctttccccagc
aactactgggacaagtttgtcaagcggaaggttctggacaaacacggggacatcttcggg
cgggagcggattgcagagctgctgggcatggatctggcctctctggagatcacagcccac
aatgagcgcaaacctgaccctccaccaggcctgctgacatggatcatgtccatcgatgtc
aaataccagatctggaagtttggagtcatcttcacagacaactctttcctgtatctgggc
tggtacatggtgatgtccctcctgggccactacaataacttcttcttcgctgcccacctc
ttggatatcgccatgggagtcaagacgctgcgcaccatcctttcatccgtcactcacaac
ggaaagcagctggtgatgacagtagggctcctggctgtagtggtctacttgtatacggtg
gtggccttcaacttcttccgcaagttctacaacaagagcgaagatgaggacgagcctgac
atgaagtgtgacgacatgatgacgtgctacctgttccacatgtatgtgggcgtccgggcc
ggtggtggcatcggggacgagatcgaggacccggctggtgatgaatatgaactgtaccgg
gtcgtcttcgacatcacctttttcttcttcgtcattgtcatcctactggctatcatccag
ggtctgattattgatgctttcggggagctccgagaccaacaagagcaagtgaaggaagac
atggagaccaagtgcttcatctgtgggataggcagtgactacttcgacacgaccccacat
gggtttgagacccacactctggaagagcacaacctagccaattacatgtttttcctgatg
tatttgataaataaggatgagacagagcacaccggtcaggagtcatatgtctggaagatg
taccaggagaggtgctgggacttcttccctgctggagactgtttccgaaagcagtatgag
gaccagcttggctga

DBGET integrated database retrieval system