KEGG   Rattus norvegicus (rat): 114207Help
Entry
114207            CDS       T01003                                 

Gene name
Ryr1, RYR-1, Ryr1l
Definition
(RefSeq) ryanodine receptor 1
  KO
K04961  
ryanodine receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Calcium signaling pathway
Apelin signaling pathway
Circadian entrainment
Long-term depression
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    114207 (Ryr1)
   04020 Calcium signaling pathway
    114207 (Ryr1)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    114207 (Ryr1)
  Nervous system
   04730 Long-term depression
    114207 (Ryr1)
  Environmental adaptation
   04713 Circadian entrainment
    114207 (Ryr1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114207 (Ryr1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114207 (Ryr1)
Ion channels [BR:rno04040]
 Ryanodine and IP3 receptors
  Ryanodine receptor (RYR)
   114207 (Ryr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Position
1q21
AA seq 4408 aa AA seqDB search
MGDGGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVP
PDLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLS
CLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERY
LHLSTASGELQVDASFMQTLWNMNPICSCCEEGFVTGGHVLRLFHGHMDECLTISPSDSD
DQRRLVYYEGGPVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALTEDQGL
VVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTY
AAPDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLD
SFSGKPRGSGPPAGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQ
EEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCAL
FSTNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKV
LDVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQY
GKWYFEVMVDEVAPFLTAQATHLRVGWALSEGYSPYPGGGEGWGGNGVGDDLYSYGFDGL
HLWTGHVARPVTSPGQHLLGPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFP
VVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLQPIKEYRREGPRGPHL
VGPSRCLSHLDFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDD
NKRLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTY
MMNNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNP
RLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQSRGDRARIFRAEK
SYAVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADDLAYVFNGHRGQRWHLGSEPF
GRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQV
GHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEPVPLEHPHYEVAR
MDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLASPGLQPPA
EDEARAAEPDTDYENLRRSAGGWGEAEAGKDGTAKEGTPGGAAQPGVEAQPARAENEKDA
TTEKNKKRGFLFKAKKVAMMTQPPSTPALPRLPRDVVPADNRDDPEIILNTTTYYYSVRV
FAGQEPSCVWVGWVTPDYHQHDMSFDLSKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGD
FVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQ
NVVQFELGKQKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLHVDTRR
AGERLGWAVQCQEPLMMMALHIPEENRCMDILELSERLDLQRFHSHTLSLYRSVCALGNN
RVAHALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLT
EETRAITLFPPGRSAEDGPRRHGLPGVGVTTSLRPPHHFSPPCFVVALPAAGAAEAPARL
SPAIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFSDED
VKQILKMIEPEVFTEEEEVEEEEEEEEEDEEEKEEDEEEEAHEKEDEEKEEAEEAAEEEK
EELEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQSNQRGRYGL
LMKAFTMSAAETARRTREFRSPPQEQINMLLQFKNGADEEDCPLPEEIREDLVNFHQDLL
AHCGIQLEGEEEEPEEESTLGSRLMSLLEKVRLVKKKEEKPEEEPAAEEHKPQSLQELVS
HTVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISLSSVEDTMSLLECL
GQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGE
SKEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAAS
VIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAV
FVNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRR
DRRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRS
LVPLDDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLL
HVLDVGFLPDMRAAASLDTVSIPTGLPPRRWALALNRYLCLAVLPLITKCAPLLRGTEHR
AIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNE
FAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQEL
YRIAMPCLCAIAGALPPDYVDASYSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFI
NKFAEYAHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKA
MIAWEWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMA
EQLAENYHNTWGRKKKQELEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGY
AVTRGLKDMELDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEI
KFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVS
LFGTDAPAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKV
SQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSL
GTTRNPYVEKLRPALGECLARLAAAMPVAFLEPELNEYNACSVYTTKSPRERAILGLPNS
VEEMCPDIPVLERLMAEIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPA
LPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLR
SHFIPTIGRLRKRAGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRY
VDNNRAHWLTXAQSQLGKLFRMVGEIFIYWSSPHEFKRVRTNFVVRTSKNMSFLTVQXSK
MAKSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIVLAKARYAL
KDTDEEVREFLQNNLNLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAV
LYHLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKASWI
LTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLY
MAYADIMAKSCHLEEGGENVEEGGEEEEVEVSFEEKEMEKQRLLYQQSRLHNRGAAEMVL
QMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCS
VLTLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNGET
GGWASKSHLTPVMCVTAMSSDVVVSLYSHVVVTRARCHQVPLSDLPLTSFQVSDSPPGED
DIEGSGAGDMFRGSGLVIGSGWGSRASEEVEGDEDENMVYYFLEGGTGYMEPALRCLSLL
HTRWPFSCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTP
SFPSNYWDKFVKRKVLDKHGDIFGRERIAELLGMDLASLEITAHNERKPDPPPGLLTWIM
SIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSS
VTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYV
GVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQ
VKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESY
VWKMYQERCWDFFPAGDCFRKQYEDQLG
NT seq 13227 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatggaggaggtgaaggcgaggacgaggtccagtttttgcggacggacgacgaa
gtggtcctgcagtgcagcgccaccgtgctcaaggagcagctcaagttgtgtctggccgct
gagggtttcggtaatcgcctctgcttcctcgaacccaccagcaacgcgcagaatgtaccc
cctgatctggccatctgctgctttatcctggagcagtctctgtcagttcgagccctgcag
gagatgctggccaatactgtggaggccggtgtagagtcatcccagggcgggggacacagg
acactcttgtatggccatgccatcctgctccggcacgcacacagccgtatgtacctgagt
tgcctcaccacctcccgatccatgactgacaagttggcctttgatgtgggattacaggaa
gacgccacaggggaggcctgttggtggacgatgcacccagcctcgaagcagaggtctgaa
ggagagaaggttcgagttggggatgacctcatccttgtgagtgtctcctctgagcgatac
ctgcacctgtcaaccgcaagtggggaactccaggtggatgcctccttcatgcagactctg
tggaatatgaaccctatctgctcctgctgtgaagaaggctttgtgactggaggacatgtc
ctccgcctctttcatggacatatggatgaatgtctgaccatttccccttctgacagtgat
gaccaacgcagacttgtctactacgagggagggcctgtgtgcacccatgcccgctccctg
tggaggctggagccactgagaatcagctggagtggaagccatctccgctggggccagcca
ctaagaatcaggcatgtgaccacagggaggtaccttgcgctcactgaggaccaaggcctt
gtggtggttgatgccagcaaggcccacaccaaggccacttccttttgcttccgcatctcc
aaggagaagctggatgtggcccccaagagagatgtggagggcatggggccccctgagatc
aagtatggagagtcactctgctttgtgcagcatgtggcctcaggtctgtggctcacctat
gcggccccagaccccaaggccctgaggcttggggtactcaagaagaaggccatgctgcac
caggaaggccacatggatgatgcgctatcactgacgcgatgccagcaggaggagtcccag
gctgcccggatgatatacagcactgcgggcctgtacaaccagttcataaagggtctcgat
agcttcagcgggaagccacggggttcggggccaccggctgggtcagcactgcccatcgag
ggcgtcatcctgagcctacaagacctcatcggctatttcgagccgccttcggaggagctg
cagcacgaggagaagcagaccaagctccgcagcctgcgcaaccgacaaagcctcttccag
gaggaggggatgctctccctggtcctgaattgcattgatcgcctcaatgtctacaccacc
gcagcccattttgctgaatttgcaggggaggaggcagctgaatcctggaaagagattgtg
aacctgctctatgaacttctagcttctctgatccgtggcaatcgcaccaactgtgccctc
ttttccacaaacttggattggctggtcagcaaactggatcgtctggaggcctcatctggc
atcctggaggtgttgtactgtgttctgattgagagtcctgaggtgctaaacatcatccag
gagaaccacatcaagtctatcatctccctcttagacaagcatgggaggaatcacaaggtc
ctggatgtgctatgctcactctgtgtgtgcaatggtgtagctgtgcgctccaaccaggat
ctcattactgagaacttgctcccgggccgtgaacttctgctgcagacaaaccttatcaac
tacgtcaccagcatccgtcccaacatctttgtgggccgagcagagggctccacgcagtat
ggcaagtggtacttcgaggtgatggtggacgaggtggctccgtttctgacagctcaggcc
acccacctgcgggtgggctgggccctcagcgagggctacagtccctaccctggaggtggc
gagggctggggcggcaacggggtcggcgatgacctctattcttacggctttgatgggctg
cacctctggacagggcatgtggcacgcccagtgacttctcccggacaacacctcttgggc
ccggaggatgtggtcagctgctgcctggacctcagcgtaccatccatctcctttcgtatc
aatggctgccccgtgcagggtgtctttgaatccttcaacctcgatgggctctttttcccc
gtcgtgagcttctccgctggtatcaaagtgcgcttcctccttggcgggcgccacggtgaa
tttaagttcctgcccccacctggctatgccccatgccatgaagctgtgcttcctcgggag
cggctccatctccaaccaatcaaagagtatcgcagggaagggcctcgggggccccacctg
gtgggccccagtcgctgcctctcacatctggactttgtgccctgccctgtggacaccatc
cagatcgtcttgcccccccacctggagcgaattcgggagaagctggcagagaacattcat
gaactctgggcactgactcgcattgagcagggatggacctatggtccggttcgggatgac
aacaagaggctgcacccatgtcttgtggattttcacagcttgccagagcctgagcggaat
tacaacttgcagatgtcaggggagacactcaagactctgctggccctgggctgccatgtc
ggcatggcagatgagaaggcagaggacaacctgaagaagacgaagctccctaagacgtat
atgatgaacaacggatataagccggctcctctggacctgagccacgtgaggctgacgcct
gcgcagacgactctggtggaccggctggcagagaacgggcacaatgtatgggcgagagac
cgggtggcacagggctggagctatagcgctgtgcaggacatccctgcacgcagaaaccct
cgcctcgtgccctaccgcctgcttgacgaggccaccaagcgcagcaaccgggacagcctc
tgccaggctgtgcgcacactcttgggctatggctacaacatcgagccacctgaccaggag
cccagtcaggtggacagccagtctcgaggcgaccgggcccgcatcttccgggcggagaag
tcctatgcagtccagagcggccgctggtacttcgagtttgaagcagtcaccacaggagag
atgcgagtggggtgggcaagacctgagctgagacctgacgtggagctgggggctgatgat
ctggcctatgtcttcaatgggcaccgaggccagcgctggcacttgggcagtgagccattc
ggacgtccctggcagtcgggtgatgtcgttggctgcatgattgatctcacggagaacacc
atcatcttcaccctcaatggcgaggtcctcatgtctgactcgggctcggaaacagccttc
cgagaaattgagattggggacggcttcctgccagtctgcagcttgggacctggtcaggtg
ggccacctgaacctgggccaggatgtgagctccctgaggttttttgccatctgtggcctc
caggaaggctttgagccgttcgccatcaacatgcaacgcccagtgaccacctggtttagc
aagagccttcctcagtttgagcctgtgcccctcgaacacccccactatgaggtggcccgc
atggatggcactgtggatacacctccctgcctgcgcttgactcaccgtacctggggctca
cagaacagtctggtggagatgctgtttctccggctaagccttccggtccagttccaccag
cacttccgctgcaccgcaggggccacacccctcgcatcccctggcctgcagccgcctgcg
gaagatgaggcccgggcagcagaaccggatacggactatgagaacctgcgccgctctgct
ggaggctggggagaggctgaggcgggcaaggatggaactgccaaggaggggacacccgga
ggcgctgcccagccaggggtagaggctcagcctgcaagggcggagaatgagaaagacgcc
accacggagaagaacaagaagagagggttcttattcaaggccaagaaggttgccatgatg
acccaaccaccttccaccccggctcttccccgactccctcgagatgtagtacctgctgac
aaccgtgacgaccctgagatcatcctcaacaccaccacgtactattactctgtgagggtc
ttcgcgggtcaggagcccagctgcgtgtgggtgggctgggtcactcctgactaccatcaa
catgacatgagcttcgacctcagcaaggtccgggcggtgacagtgaccatgggggatgaa
caaggcaatgtccacagcagcctcaagtgtagcaactgttacatggtgtggggcggggat
ttcgtgagtccgggacagcaaggccgcatcagccacacggacctagtcattggatgcctg
gtggatctggccaccggcttgatgacctttacagccaatggcaaagaaagcaacaccttc
ttccaggtggagcccaacacaaagctgtttcctgccgtctttgtcctgcccacccaccag
aacgtggtccagtttgagttggggaagcaaaagaacatcatgccgctgtcagccgccatg
ttcctcagcgagcgcaagaatccagccccgcagtgcccaccaaggctggaggtgcagatg
ctgatgcctgtctcctggagccgaatgcccaaccacttcctacatgtggacacgcggcgt
gctggcgagcggctgggctgggctgtgcagtgccaggagccgctgatgatgatggcgcta
cacatcccggaggagaacaggtgcatggacatcctggagctgtctgagcggctggatcta
cagcgcttccactcgcacacgctctcgctctaccgctccgtgtgcgccctgggcaacaac
cgcgtggctcatgccctgtgcagccacgtggaccaggcacagctgctgcatgctctggaa
gacgcgcacttgccgggtcctctgcgtgcaggctactatgacctcctcatcagcatccac
ctcgaaagcgcctgccgcagccgtcgctccatgctctctgagtacattgtgccgctcaca
gaggagacccgagccatcacgcttttcccacccggtcgtagcgcggaagatggcccccgc
cgccatggcctgcctggcgttggggtcacaacctccctgagacctccacaccacttctca
cccccgtgttttgtggtcgccctgccagctgctggggccgcagaagctccggctcgcctc
agccctgccatccctctggaggctctgcgagacaaggcgctgagaatgttgggggaagcc
gtgcgtgacggaggacagcatgctcgcgacccagtagggggctctgtggagttccagttt
gtgccggtgctcaagcttgtgtctaccctcctggtgatgggtgtctttagcgacgaggat
gtgaagcagatcctgaagatgatagagcctgaagtcttcaccgaggaagaagaggtggag
gaggaggaagaggaggaagaggaagatgaggaggagaaagaggaggacgaggaggaagag
gcacacgagaaggaagatgaggaaaaagaagaggcagaggaggccgcagaggaggagaag
gaagagctggaggaggggctgctgcagatgaagttgcctgagtctgtgaaattacagatg
tgccacctcctggagtatttctgtgaccaagagctgcagcaccgggtggagtccttggca
gcctttgcggagcgatatgtggacaagctgcagagcaatcagcggggtcgctacggcctc
ctcatgaaagccttcaccatgagcgcggccgagactgcaaggcgcacgcgggagttccgc
tctccgccccaagagcagatcaacatgctattgcaattcaaaaatggtgccgatgaggaa
gattgtcctctccctgaagagatccgagaggatttagttaactttcaccaagacctgttg
gcacattgtggaatccagctggagggagaggaggaggagccagaggaagagagcactctg
ggcagccgcctcatgagcctgttggagaaggtgcggctggtgaagaagaaagaggagaag
cctgaggaggagccggcagctgaggagcacaagcctcagtccttgcaggagctggtgtcg
cacacagtggtgcgctgggcccaggaggacttcgttcagagcccagagctggtccgagcc
atgttcagcctcctgcaccggcagtacgatggactcggcgagctgctgcgtgccctgcct
cgggcctacacgatctctctgtcctcagtggaggacaccatgagcctgctggagtgtctg
ggccagatacgctcactgcttattgtgcagatgggtccccaggaggagaacctcatgatc
cagagcattgggaacatcatgaataacaaagtcttctaccagcacccaaacctgatgaga
gcgctcggtatgcacgaaactgtcatggaggtcatggtgaatgtcctcgggggcggcgag
tcaaaggagatccgcttccccaagatggtgacaagctgctgccgtttcctctgctacttc
tgccggatcagccggcagaaccagcgctctatgtttgaccacctgagctacctgctggag
aacagtggcattggcctggggatgcagggctccacgcccctggatgtagcagctgcttct
gtcattgacaacaatgagctggccttggcattacaggagcaagacctggaaaaggttgtg
tcatacttggcagggtgtggcttacaaagctgccccatgctcctggccaaaggctatcct
gacatcggatggaatccctgtgggggcgagcgctacctggacttcctgcgctttgccgtc
tttgtcaacggtgagagcgtggaagagaacgctaatgtggtagtgcggctgttgatccga
aagcccgagtgctttggacctgccctgcggggtgagggtggctcagggctgctggctgcc
atcgaagaagccatccgcatctccgaggaccctgcacgggatgggccgggtgtccgcagg
gaccggcgacgtgagcactttggtgaggaaccccctgaagagaaccgggtacatctagga
cacgccatcatgtccttctatgctgctttgattgacctgctgggacgctgtgctcctgag
atgcatctgattcaagccggtaagggtgaggccctgaggatccgtgctatccttcggtcc
ctcgtgcctttggatgaccttgtgggcatcatcagcctcccactgcagatccccaccctg
ggcaaagatggcgcactggttcagccaaagatgtctgcatccttcgtgcctgaccacaag
gcatccatggtgcttttcctggaccgagtgtatggcattgagaaccaggacttcttgctg
catgtgctggatgtggggttccttcctgacatgagggcagctgcctcactggacacggtg
agcatccccaccgggctaccaccccggagatgggcgctggcacttaaccgctacttgtgc
ctggctgtgctgccgctcatcaccaagtgcgcgccactcttgcggggcaccgagcaccgc
gccatcatggtggactccatgctgcacacagtataccgactgtcgcggggccgctcgctc
accaaagcacagcgcgacgtcattgaggactgcctcatggcgctgtgcaggtatatccgc
ccgtccatgctgcagcacctgcttcgacgcctggtgttcgatgtgcccatcctcaatgag
tttgccaagatgcctctcaagctccttaccaaccactacgagcgttgctggaagtactac
tgccttcccacaggctgggccaacttcggggtcacctctgaggaagagctgcacctcaca
cgcaagctcttctggggcatctttgattctctggcgcataagaaatacgaccaggagctt
taccgaatagccatgccgtgtctctgtgccattgcgggggcactgccccccgactatgtg
gatgcctcatactcctccaagacggagaaaaaagccacagtggatgcggaaggcaacttt
gatccccggcctgtggagaccctcaatgtcatcatcccagagaagctggactccttcatt
aacaagttcgcagaatatgcccatgagaagtgggcctttgacaagattcagaacaactgg
tcctatggcgagaacattgatgaagaactgaagacccaccccatgctgagaccctacaag
accttctcagagaaggacaaagagatttaccgctggcccatcaaggagtccttgaaggcc
atgattgcctgggaatggacggtcgagaaggccagggaaggtgaggaggaaaagaccgaa
aagaaaaaaacaagaaagatatcccaaacggcccagacatatgaccctcgagaaggctac
aatccccagccaccagacctcagtgtggttacgttgtcccgggagctgcaggccatggct
gaacaattggcagagaattatcacaacacttgggggcgaaagaagaagcaagagctggag
gctaaagggggtgggtcccatcctctgctggtcccctacgacacgcttacggccaaggag
aaggcgcgggaccgggagaaggcccaggagttgctgaagtttctgcagatgaatggctat
gctgtcaccaggggtcttaaggacatggaactggacacatcttccattgagaaacgattt
gcctttggcttcctgcagcagctgctgcgctggatggacatctcccaggagtttatcgcc
cacttggaggctgtggtcagcagtggacgggtagagaaatccccacatgaacaggagatt
aaattctttgctaagattctgctgcctttaatcaaccaatacttcaccaaccactgtctc
tacttcctatccacaccggccaaagtgctgggcagtggtggccatgcctccaacaaggag
aaggaaatgatcaccagcctcttctgtaaacttgctgctcttgtccgccaccgagtctcc
ctctttgggacggatgccccagctgtggtcaactgtcttcatatattggcacgttccctg
gatgccaggacggtgatgaaatcgggccctgagatcgtaaaggcgggtctgcgctccttc
ttcgagagtgcctcggaggacattgagaagatggtggagaacctgcggctaggcaaggtg
tcccaggcacgcacgcaggtgaagggtgtgggccagaacctcacctacaccacagtggct
ctgctgcctgtcctcaccaccctcttccagcacatcgcccagcaccagttcggagatgat
gtcatcctggatgacgttcaagtttcttgctaccgaacactatgcagtatctactctctg
ggaaccaccaggaacccctacgtggaaaagctgcggccagccctgggggaatgcctggcc
cgcctggccgcagccatgccagtggcattcctggagcctgagctgaatgaatacaacgcc
tgctctgtctacaccaccaagtctcctcgagagcgggccatcctggggcttcccaacagt
gtggaagagatgtgtccagacatcccggtgctagaacggcttatggcagagatcgggggg
ctggccgagtccggggcgcgctacaccgagatgccgcacgtcatcgagatcacactgcct
atgctgtgcagctacctgccccgctggtgggagcgagggcctgaggcgcccccaccagcc
ctgcctgcaggagccccaccaccctgtacagccgtcacctccgatcacctcaattcccta
ctggggaacatccttcgaatcatcgtcaataacctgggcatcgatgaggcctcgtggatg
aagcggttggctgtgtttgcccagcccatcgtgagccgtgccaggccagagctcctacgc
tcccacttcatccctactatcgggcgactgcgtaagcgggcagggaaggtggtggctgag
gaggagcagctgcgcctggaggccaaggcagaggctgaggagggtgagctcctggtccgg
gatgagttctccgtgctctgccgtgacctgtatgccctctacccactgctcatccgctac
gtagacaacaacagggcacactggctgacatgagcccaatcccaactcgggaagctgttc
aggatggtgggagaaatcttcatctactggtcaagtccccacgaatttaagcgtgtaaga
acgaacttcgtggtccgaacgagtaaaaacatgtcctttttgaccgtacaantgagcaaa
atggccaagtcaggtggctcggaccaggaacgcaccaagaagaaacgccggggggaccgc
tactcggtgcagacatccttgatcgtggccacgctcaagaagatgttaccgataggacta
aacatgtgtgctcccactgaccaggacctcattgtgctggccaaggcccgctatgcgctg
aaagatacagatgaggaggttcgtgaattccttcaaaacaaccttaaccttcagggaaag
gtggaaggctcaccatctcttcgctggcaaatggcactgtaccgcggcgttccaggccgc
gaggaagatgccgatgatcctgagaaaatcgtgcgcagagtccaggaagtgtccgctgtg
ctctatcacctagaccagacggagcatccttacaagtccaagaaggcggtgtggcataaa
cttttgtccaagcaacgccggagggcagtggtggcctgtttccgcatgacgcccctatac
aacttacccacgcaccgagcatgcaacatgttcttggagagctacaaagcctcctggatc
ctgactgaggaccacagtttcgaggaccgcatgatagatgacctatcaaaagctggggag
caggaggaagaggaggaagaagtggaggagaagaagccagaccccctacaccagttggtc
ctacacttcagccggacagctctgactgaaaagagcaaactggatgaggactacctgtac
atggcttacgctgacatcatggcaaagagctgccacctggaggagggcggggaaaatgtc
gaagaaggaggtgaagaagaggaagtggaggtgtcctttgaggagaaggagatggagaag
cagaggctcctgtaccagcagtcgaggctgcacaaccggggtgccgccgagatggtactg
cagatgatcagtgcttgcaaaggagagacgggtgccatggtgtcttccaccctgaagctg
ggcatctccatcctcaacggagggaacgctgaagtgcagcagaaaatgctggattacctg
aaggacaagaaggaagtgggcttcttccagagtatccaggcgctaatgcaaacgtgcagc
gtcctgaccctcaatgcctttgagaggcagaacaaggcggaggggctgggcatggtgaat
gaagacgggactgtcatcaatcgccagaacggagagaaagtcatggcagatgatgagttc
acacaggacctgttccgcttcctgcagctgctctgcgagggccataacaacggtgagaca
ggagggtgggcttccaaaagtcacctgacacctgtgatgtgtgtgactgcgatgtcgtct
gacgtcgtggtgtcgttgtactctcatgtcgtcgtgactcgtgccaggtgccaccaggtc
cccctttctgatttgcctttgacctcatttcaggtttcagactctccgccaggggaggat
gacatagaaggttccggagctggggacatgttcaggggcagtggtctggtgattggctct
ggctggggctccagagccagcgaggaggtagagggtgatgaagatgagaacatggtgtac
tacttcctggagggaggcaccggctacatggaacctgccctgaggtgcttgagcctgctg
catacccggtggcctttctcgtgcatcattggctacaactgtctcaaggtgccccttgtg
atctttaagagggagaaggagctggcccggaagctggagttcgatggtctctacattaca
gagcagccagaggatgatgatgtgaagggacagtgggatcgcctggtgctcaacacaccg
tctttccccagcaactactgggacaagtttgtcaagcggaaggttctggacaaacacggg
gacatcttcgggcgggagcggattgcagagctgctgggcatggatctggcctctctggag
atcacagcccacaatgagcgcaaacctgaccctccaccaggcctgctgacatggatcatg
tccatcgatgtcaaataccagatctggaagtttggagtcatcttcacagacaactctttc
ctgtatctgggctggtacatggtgatgtccctcctgggccactacaataacttcttcttc
gctgcccacctcttggatatcgccatgggagtcaagacgctgcgcaccatcctttcatcc
gtcactcacaacggaaagcagctggtgatgacagtagggctcctggctgtagtggtctac
ttgtatacggtggtggccttcaacttcttccgcaagttctacaacaagagcgaagatgag
gacgagcctgacatgaagtgtgacgacatgatgacgtgctacctgttccacatgtatgtg
ggcgtccgggccggtggtggcatcggggacgagatcgaggacccggctggtgatgaatat
gaactgtaccgggtcgtcttcgacatcacctttttcttcttcgtcattgtcatcctactg
gctatcatccagggtctgattattgatgctttcggggagctccgagaccaacaagagcaa
gtgaaggaagacatggagaccaagtgcttcatctgtgggataggcagtgactacttcgac
acgaccccacatgggtttgagacccacactctggaagagcacaacctagccaattacatg
tttttcctgatgtatttgataaataaggatgagacagagcacaccggtcaggagtcatat
gtctggaagatgtaccaggagaggtgctgggacttcttccctgctggagactgtttccga
aagcagtatgaggaccagcttggctga

DBGET integrated database retrieval system