KEGG   Rattus norvegicus (rat): 114246Help
Entry
114246            CDS       T01003                                 

Gene name
Trpv6, CaT1, Ecac2, Otrpc3
Definition
(RefSeq) transient receptor potential cation channel, subfamily V, member 6
  KO
K04975  
transient receptor potential cation channel subfamily V member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
Salivary secretion
Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    114246 (Trpv6)
   04978 Mineral absorption
    114246 (Trpv6)
Ion channels [BR:rno04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPV (Vanilloid)
   114246 (Trpv6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q22
AA seq 727 aa AA seqDB search
MGWSLPKEKGLILCLWNKFCRWFHRRESWAQSRDEQNLLQQKRIWESPLLLAAKENNVQA
LIKLLKFEGCEVHQKGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTA
LHIAVINQNVNLVRALLARGASVSARATGSVFHYRPHNLIYYGEHPLSFAACVGSEEIVR
LLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGL
TPFKLAGVEGNIVMFQHLMQKRKHIQWTYGPLTSTLYDLTEIDSSGDDQSLLELIVTTKK
REARQILDQTPVKELVSLKWKRYGRPYFCVLGAIYVLYIICFTMCCVYRPLKPRITNRTN
PRDNTLLQQKLLQEAYVTPKDDLRLVGELVSIVGAVIILLVEIPDIFRLGVTRFFGQTIL
GGPFHVIIVTYAFMVLVTMVMRLTNSDGEVVPMSFALVLGWCNVMYFARGFQMLGPFTIM
IQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTII
DGPANYDVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVVATT
VMLERKLPRCLWPRSGICGREYGLGDRWFLRVEDRQDLNRQRIRRYAQAFQQQDDLYSED
LEKDSGEKLEMARPFGAYLSFPTPSVSRSTSRSSTNWDRLRQGALRKDLQGIINRGLEDG
EGWEYQI
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggggtggtcactgcccaaggagaaggggttaatactctgcctatggaacaagttctgc
agatggttccacagacgagagtcctgggctcagagccgagatgagcagaacctgctgcag
cagaagaggatctgggagtcgcctcttcttctagctgccaaagaaaacaatgtccaggct
ctgatcaaactgctcaagtttgaaggatgtgaggtgcaccagaaaggagccatgggggaa
actgcacttcacatagctgccctctatgataacctggaggctgccatggtgctaatggag
gctgccccagaactggtttttgagcccatgacttcagagctatatgaaggtcagactgca
ctgcacattgcagtaataaaccagaatgtgaacttggtccgtgctctgcttgcccgaggg
gccagtgtctccgccagagctacgggctctgtcttccactacaggcctcacaatctcatt
tactatggagaacatcctttgtcctttgctgcctgtgtgggtagtgaggagattgttaga
ctgctcatcgagcatggggctgacattcgggcccaggactccttgggaaatacagtacta
cacatactcatcttgcagcccaacaaaacctttgcctgccagatgtacaacctgctactg
tcctatgatgggggagaccacctgaagtcccttgaacttgtgcccaataaccaaggactc
acccctttcaagttggctggggtggaaggcaacattgtgatgttccaacacctgatgcag
aagcggaaacacatccagtggacttatgggccattgacttccacactttatgacctcact
gagattgactcctcaggggatgatcaatctctactggaacttattgttaccaccaagaag
cgggaggctcgccagatcctggaccagacacctgtgaaggaactggtgagcctcaagtgg
aagaggtatgggcggccctacttctgtgtgctgggtgccatctacgtgctctacatcatc
tgctttaccatgtgctgtgtctaccgcccactcaagcccaggatcactaaccgcaccaac
cccagggacaataccctcctgcagcagaagctccttcaggaggcctatgtgacccccaag
gatgatctccggctggtgggggagctggtgagcatcgttggggctgtgatcatcctgctg
gtggagattccagacatcttcaggttgggggtcactcgattttttgggcagaccattctt
ggggggccattccatgtcatcattgtcacttatgccttcatggtgctggtgaccatggtg
atgcggctcaccaactcagatggagaggtggtgcccatgtcgtttgctctggtgttgggc
tggtgcaatgtcatgtactttgccagaggattccaaatgctgggtcccttcaccatcatg
atccagaagatgatttttggtgacttgatgcgattctgctggctgatggctgtggtaatc
ttgggatttgcttcagccttctatatcatcttccagacagaggaccccgatgagctgggc
catttctatgactaccccatggcactgttcagcacctttgaactcttcctcaccatcatc
gatggccctgccaactatgacgtggatctgcccttcatgtacagcatcacctacgctgcc
tttgccatcatcgccacactgctcatgctcaacctcctaattgccatgatgggtgacact
cactggagagttgcccatgagcgggatgagctctggagagcacaggttgtggctactacc
gtgatgctagaacggaagctgcctcgctgcctgtggcctcgatctgggatatgtgggcga
gagtatggtcttggggaccgctggttcttgagggtggaagatagacaagatctcaacaga
caacgcatccgccgctatgcacaggccttccagcaacaagatgacctctactctgaggac
ttggaaaaagactcaggagaaaaactggagatggcacgaccctttggtgcctatctgtcc
tttcctacaccctcagtgtctcgaagtacctcccgaagcagcaccaattgggacaggctt
cgacaaggggccctaaggaaggaccttcaagggataatcaaccggggcctggaagatggg
gagggctgggagtaccagatctaa

DBGET integrated database retrieval system