KEGG   Rattus norvegicus (rat): 114486Help
Entry
114486            CDS       T01003                                 

Gene name
Braf
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  
B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
MAPK signaling pathway
ErbB signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Vascular smooth muscle contraction
Dorso-ventral axis formation
Focal adhesion
Natural killer cell mediated cytotoxicity
Long-term potentiation
Neurotrophin signaling pathway
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Alcoholism
Hepatitis C
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Breast cancer
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    114486 (Braf)
   04010 MAPK signaling pathway
    114486 (Braf)
   04012 ErbB signaling pathway
    114486 (Braf)
   04068 FoxO signaling pathway
    114486 (Braf)
   04024 cAMP signaling pathway
    114486 (Braf)
   04150 mTOR signaling pathway
    114486 (Braf)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    114486 (Braf)
  Cellular community - eukaryotes
   04510 Focal adhesion
    114486 (Braf)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    114486 (Braf)
   04062 Chemokine signaling pathway
    114486 (Braf)
  Endocrine system
   04910 Insulin signaling pathway
    114486 (Braf)
   04914 Progesterone-mediated oocyte maturation
    114486 (Braf)
  Circulatory system
   04270 Vascular smooth muscle contraction
    114486 (Braf)
  Nervous system
   04726 Serotonergic synapse
    114486 (Braf)
   04720 Long-term potentiation
    114486 (Braf)
   04730 Long-term depression
    114486 (Braf)
   04722 Neurotrophin signaling pathway
    114486 (Braf)
  Development
   04320 Dorso-ventral axis formation
    114486 (Braf)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    114486 (Braf)
   05205 Proteoglycans in cancer
    114486 (Braf)
   05210 Colorectal cancer
    114486 (Braf)
   05212 Pancreatic cancer
    114486 (Braf)
   05214 Glioma
    114486 (Braf)
   05216 Thyroid cancer
    114486 (Braf)
   05221 Acute myeloid leukemia
    114486 (Braf)
   05220 Chronic myeloid leukemia
    114486 (Braf)
   05218 Melanoma
    114486 (Braf)
   05211 Renal cell carcinoma
    114486 (Braf)
   05219 Bladder cancer
    114486 (Braf)
   05215 Prostate cancer
    114486 (Braf)
   05213 Endometrial cancer
    114486 (Braf)
   05224 Breast cancer
    114486 (Braf)
   05223 Non-small cell lung cancer
    114486 (Braf)
  Substance dependence
   05034 Alcoholism
    114486 (Braf)
  Infectious diseases
   05160 Hepatitis C
    114486 (Braf)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    114486 (Braf)
   01522 Endocrine resistance
    114486 (Braf)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114486 (Braf)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: TKL group
  RAF family [OT]
   114486 (Braf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
4q21-q22
AA seq 804 aa AA seqDB search
MAALSGGGGSSSGGGGGGGGGGGGGGGGGAEQGQALFNGDMEPEAGAGAAASSAADPAIP
EEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLV
FQTPTDVSRNNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAV
YRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQ
GFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPVPQEEAFSAETTLPSGCS
SAPPSDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVN
IDEKFPEVELQDQRDLIRDQGFRGDGAPLNQLMRCLRKYQSRTPSPLLHSVPSEIVFDFE
PGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSSSTEDRSRMKTLGR
RDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVG
VLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQG
MDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPE
VIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRS
NCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDF
SLYACASPKTPIQAGGYGEFAAFK
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgagtggcggcggtggcagcagcagcggtggcggtggcggcggcggcggc
ggcggtggtggcggcggcggcggcggcgccgaacagggacaggctctgttcaatggcgac
atggagccggaggccggcgctggcgccgcggcctcttcggccgcggacccggccattcct
gaagaggtgtggaatatcaagcaaatgattaagttgacacaggaacatatagaggcccta
ttggacaagtttggtggggagcataacccaccgtcaatatacctggaggcctatgaagag
tacaccagcaagctagatgcccttcagcagagagagcagcagctgttggaatccctggtt
tttcaaactcccacagatgtatcacggaacaaccccaagtcaccacagaaacctatcgtt
cgtgtcttcctgcccaacaaacagaggacagtggtgcccgcaagatgtggtgtaacggtc
cgagacagtctaaagaaagcactaatgatgaggggtctcatcccagagtgctgtgctgtt
tacagaattcaggacggagagaagaaaccaattggctgggacactgacatttcctggctt
actggagaggagctacatgttgaagtactagagaatgttcctctgacaacccacaacttc
gtacggaaaacttttttcaccttagcattttgtgacttttgccgaaagctgcttttccag
ggtttccgctgtcaaacatgtggttataagtttcaccagcgttgtagtacagaggttcca
ctgatgtgtgttaattatgaccaacttgatttgctgtttgtctccaagttctttgagcat
cacccagtaccacaggaggaggccttctcagcagagactacccttccatctggatgctct
tccgcacccccctcagactctattgggccccaaatcctcaccagtccatctccttcaaaa
tccattccaattccacagcccttccggccagcagatgaagatcatcgcaatcagtttggg
caacgagaccgctcctcctccgctcccaatgttcatataaacacaatcgaacctgtcaat
attgatgaaaaattcccagaagtggaattacaggatcaaagggatttgattagagaccag
gggtttcgtggggatggagcccctttgaaccagctgatgcgctgtcttcggaaataccaa
tcccggactcccagccccctcctccattctgtccccagtgaaatagtgtttgattttgag
cctggcccagtgttcagagggtcaaccacaggcttgtcggccaccccacctgcctcatta
cctggctcactcactaacgtgaaagccttacagaaatctccaggacctcagcgggaaagg
aagtcctcctcctcctcctcctccacggaagacagaagtcggatgaaaacacttggtaga
agagattcaagtgatgattgggagattcctgatggacagattacagtgggacagagaatt
ggatctgggtcctttggaactgtctacaagggaaagtggcatggcgacgtggcagtgaaa
atgctgaatgtgacagcacccacacctcagcagttacaggccttcaaaaacgaagtcgga
gtactcaggaaaactcgacatgtgaacatcctccttttcatgggctattctacaaagcca
cagctggctattgttacacagtggtgtgaaggctccagcttatatcaccatctccacatc
attgagaccaaatttgagatgatcaaacttatagatattgcacggcagactgcacagggc
atggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatattt
cttcatgaagacctcacggtaaaaataggtgactttggtttagccacagtgaagtcccga
tggagtgggtcccatcagtttgaacagttgtctggatctattttgtggatggcacccgaa
gtaatcagaatgcaagataaaaacccatatagctttcagtcagacgtgtatgcatttggg
attgttctgtatgaactgatgactggtcagctaccttattcaaacatcaacaacagggat
cagataatttttatggtgggacgaggatacctatctccagatctcagtaaggtacggagt
aactgtccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagacgag
agaccactctttccccaaattctcgcctctattgagctgctggcccgctcattgccaaaa
attcaccgcagtgcatcagaaccctccttgaatcgggctggtttccaaacagaagatttt
agtctgtatgcttgtgcttctccaaaaacacccatccaagcagggggatatggagaattt
gcagccttcaagtag

DBGET integrated database retrieval system