KEGG   Rattus norvegicus (rat): 114495Help
Entry
114495            CDS       T01003                                 

Gene name
Map2k6, Mkk6
Definition
(RefSeq) mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04218  Cellular senescence
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05145  Toxoplasmosis
rno05164  Influenza A
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05418  Fluid shear stress and atherosclerosis
Module
rno_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    114495 (Map2k6)
   04010 MAPK signaling pathway
    114495 (Map2k6)
   04668 TNF signaling pathway
    114495 (Map2k6)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    114495 (Map2k6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    114495 (Map2k6)
   04664 Fc epsilon RI signaling pathway
    114495 (Map2k6)
  Endocrine system
   04912 GnRH signaling pathway
    114495 (Map2k6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    114495 (Map2k6)
  Development
   04380 Osteoclast differentiation
    114495 (Map2k6)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    114495 (Map2k6)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    114495 (Map2k6)
  Infectious diseases
   05164 Influenza A
    114495 (Map2k6)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    114495 (Map2k6)
   05169 Epstein-Barr virus infection
    114495 (Map2k6)
   05145 Toxoplasmosis
    114495 (Map2k6)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     114495 (Map2k6)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE7 family
   114495 (Map2k6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase Choline_kinase DUF4344 CLP1_P APH
Motif
Other DBs
NCBI-GeneID: 114495
NCBI-ProteinID: NP_446155
RGD: 620666
Ensembl: ENSRNOG00000004437
UniProt: Q925D6
Position
10q32.1
AA seq 334 aa AA seqDB search
MSQSKGKKRNPGLKIPREAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSADFVDFTSQCLKKNSK
ERPTYPELMQHPFFTVHEAKAADVASFVKLILGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccccggccttaagattccaagggaagcgttt
gaacaacctcagaccagttccacgccgcctcgggatttagactccaaggcttgcatttct
attggaaaccagaactttgaggtgaaggccgatgacttggagcctatagtggagctggga
cgaggtgcgtacggggtggtggagaagatgcgtcacgtgcccagcgggcagatcatggcg
gtgaagcggatacgggccacagttaatagccaggagcagaaacggctactgatggatctg
gatgtttctatgaggacagtggactgtccgtttaccgtgaccttctatggtgcactcttc
cgggagggcgatgtgtggatctgcatggagctcatggatacgtcactagataaattctac
aaacaagttattgataaaggccaaacaattccagaagatatcttagggaagatagcagtt
tctattgtaaaagcattagaacatttacacagtaagctctctgttatccatcgagatgtc
aagccttcaaatgtgctcattaacacgctgggccaagtgaagatgtgtgactttggaatc
agcggctacctggtagactctgttgcgaaaacgatcgatgccggttgcaaaccatacatg
gctcctgaacgaataaatccagagctcaaccagaaggggtacagtgtgaagtctgacatt
tggagtctgggcatcaccatgattgagctggccatcctccggtttccctatgattcttgg
ggaacgcccttccagcagctaaaacaggtggtagaagagccgtctccacaactcccagcg
gacaagttctctgctgacttcgttgactttacctcacagtgcttgaagaaaaattccaaa
gaacggcccacgtatccagagcttatgcaacatccatttttcaccgtccatgaagccaaa
gcagcagatgtggcgtctttcgtaaaactgatactcggggactaa

DBGET integrated database retrieval system