KEGG   Rattus norvegicus (rat): 114509Help
Entry
114509            CDS       T01003                                 

Gene name
Mapk7, Bmk1, Erk5, Prkm7
Definition
mitogen-activated protein kinase 7 (EC:2.7.11.24)
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:rno04010]
Cellular Processes; Cell communication; Gap junction [PATH:rno04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:rno04912]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:rno04921]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:rno04722]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:rno05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q23
AA seq 812 aa AA seqDB search
MAEPLKEEDGEDGSGEPPGRVKAEPVHSAASVVAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFRSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPVCPDVEMP
SPWAPSGDCAMESPPPALPPCSGPAPDTVDLTLQPAPPASELAPPKREGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGTLGGPSTDPLAGLVLSDNDRSLLERWTRMARPPVPAPAPAPAPTPKPTPTPTQS
SAQPTSPPNGPVSQSTAPLQPAGSIPGPASQPVCPPPGPVPQPAGPVPAPLQTAPSTSLL
ASQSLVPPSGLPGSGAPEVLPYFPSGPPPPDPGLTPQPSTSESPDVNLVTQQLSKSQVED
PLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDSQADSASLSASLLADWLEG
HGMNPADIESLQREIQMDSPMLLSDLPDLQEP
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaccgttgaaggaggaggacggcgaagatggctctggggaaccccctgggcgg
gtgaaggcagaacccgtccactccgctgcatctgtcgtggccaagaacctggccctgctc
aaagcccgctccttcgacgtgacctttgacgtgggggacgagtacgagatcatcgagacc
ataggcaatggggcctacggggtggtgtcctcggcgcgccgccgcctcacgggtcagcag
gtggccatcaagaagatacctaatgcttttgatgtggtgaccaatgccaaacggaccctc
agggaactgaagatcctcaaacacttcaaacacgacaatatcatcgccatcaaggacatc
ctgaggcccactgtgccctatggagaattcagatctgtctacgtggtactggacctcatg
gaaagtgacctacaccagatcattcactcttcacagccgctcacactagaacatgtgaga
tacttcctataccagctgcttcggggcctcaaatacatgcactctgctcaggtcatccac
cgcgatcttaaaccctctaaccttttggtcaatgagaactgtgagctcaagattggtgac
tttggaatggcccgtggcctgtgtacatcccctgccgagcaccagtacttcatgactgag
tatgtggccactcgctggtaccgtgctcctgaactcatgctttcgctgcatgagtacaca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggctcggcgacag
ctcttcccaggcaaaaactatgtgcatcagttacagctgatcatgatggtgttgggaact
ccatcaccagctgtgattcaggctgtgggggctgaaagggtgcgagcctatatccagagc
ctgccaccaaggcagcctgtaccttgggagacagtatacccgggtgctgaccgccaggcc
ctctcactgctgggacgcatgttgcgatttgaacccagtgcccgaatctcagctgctgct
gcccttcgccaccccttcctggctaagtaccacgaccctgacgatgagcctgattgcgcc
ccaccttttgactttgcttttgaccgtgaagcccttaccagggagcgcattaaggaggcc
attgtggctgagattgaggacttccatgcacgacgggagggcatccgccaacaaattcgc
ttccagccctctttgcagcctgtggctagtgagcctgtgtgtccagatgtcgagatgccc
agcccctgggctccaagtggagactgtgccatggagtcacctcctccagcactaccacca
tgctctggccctgcccctgacactgttgatctgactctgcagcctgccccgcccgccagt
gagcttgctccgccaaaaagagagggtgccatctccgacaataccaaagcagccctcaaa
gctgctctgctcaagtccctgaggagccggcttcgagatgggcccagtgcacccttggag
gcccctgaacctcgaaagcctgtgacagctcaggaacgtcagcgagagcgagaagagaag
cgcaggaggcgacaagagagagccaaggagagggagaagcgacgacaagagcgggagcgc
aaggagaggggggctggcaccttggggggcccctctactgaccctttggctggattggtg
ctcagtgacaatgaccgaagcctgctagagcggtggactcgcatggctaggcctcctgtc
cctgcaccagcaccagcaccagcaccaacaccaaaaccaacaccaacaccaacacagtcc
tctgctcaacccactagtcctcccaatggccctgtatctcagtctactgctcctctacag
cctgcaggctctattcctggtcctgcctcccagcctgtttgcccaccccctgggcctgtt
ccccagcctgctggccctgtccctgcccctctccagactgccccttccactagccttttg
gcctcccagtcacttgtgccacctagtgggttgcctggttctggtgccccagaagttctg
ccttacttcccatctggcccaccacctccagatcctgggctcacccctcagccttctaca
tcagagtcacctgatgtcaacctggtgacccagcaactgtccaagtctcaggtggaggac
cccctgcctcccgtgttctcaggcactccaaagggcagtggggctggctacggtgttggc
tttgacctggaggaattcttaaaccaatcttttgacatgggtgtggctgatgggccacag
gatagccaggcagactcagcctcactctcagcctccctccttgctgactggcttgagggc
cacggcatgaaccccgctgacattgagtctctgcagcgtgagatccagatggactcccca
atgttgctgtctgacctgcctgacctccaagaaccctga

DBGET integrated database retrieval system