KEGG   Rattus norvegicus (rat): 114509Help
Entry
114509            CDS       T01003                                 

Gene name
Mapk7, Bmk1, Erk5, Prkm7
Definition
mitogen-activated protein kinase 7 (EC:2.7.11.24)
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    114509 (Mapk7)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    114509 (Mapk7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    114509 (Mapk7)
   04921 Oxytocin signaling pathway
    114509 (Mapk7)
  Nervous system
   04722 Neurotrophin signaling pathway
    114509 (Mapk7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    114509 (Mapk7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     114509 (Mapk7)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   114509 (Mapk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q23
AA seq 812 aa AA seqDB search
MAEPLKEEDGEDGSGEPPGRVKAEPVHSAASVVAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFRSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPVCPDVEMP
SPWAPSGDCAMESPPPALPPCSGPAPDTVDLTLQPAPPASELAPPKREGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGTLGGPSTDPLAGLVLSDNDRSLLERWTRMARPPVPAPAPAPAPTPKPTPTPTQS
SAQPTSPPNGPVSQSTAPLQPAGSIPGPASQPVCPPPGPVPQPAGPVPAPLQTAPSTSLL
ASQSLVPPSGLPGSGAPEVLPYFPSGPPPPDPGLTPQPSTSESPDVNLVTQQLSKSQVED
PLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDSQADSASLSASLLADWLEG
HGMNPADIESLQREIQMDSPMLLSDLPDLQEP
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaccgttgaaggaggaggacggcgaagatggctctggggaaccccctgggcgg
gtgaaggcagaacccgtccactccgctgcatctgtcgtggccaagaacctggccctgctc
aaagcccgctccttcgacgtgacctttgacgtgggggacgagtacgagatcatcgagacc
ataggcaatggggcctacggggtggtgtcctcggcgcgccgccgcctcacgggtcagcag
gtggccatcaagaagatacctaatgcttttgatgtggtgaccaatgccaaacggaccctc
agggaactgaagatcctcaaacacttcaaacacgacaatatcatcgccatcaaggacatc
ctgaggcccactgtgccctatggagaattcagatctgtctacgtggtactggacctcatg
gaaagtgacctacaccagatcattcactcttcacagccgctcacactagaacatgtgaga
tacttcctataccagctgcttcggggcctcaaatacatgcactctgctcaggtcatccac
cgcgatcttaaaccctctaaccttttggtcaatgagaactgtgagctcaagattggtgac
tttggaatggcccgtggcctgtgtacatcccctgccgagcaccagtacttcatgactgag
tatgtggccactcgctggtaccgtgctcctgaactcatgctttcgctgcatgagtacaca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggctcggcgacag
ctcttcccaggcaaaaactatgtgcatcagttacagctgatcatgatggtgttgggaact
ccatcaccagctgtgattcaggctgtgggggctgaaagggtgcgagcctatatccagagc
ctgccaccaaggcagcctgtaccttgggagacagtatacccgggtgctgaccgccaggcc
ctctcactgctgggacgcatgttgcgatttgaacccagtgcccgaatctcagctgctgct
gcccttcgccaccccttcctggctaagtaccacgaccctgacgatgagcctgattgcgcc
ccaccttttgactttgcttttgaccgtgaagcccttaccagggagcgcattaaggaggcc
attgtggctgagattgaggacttccatgcacgacgggagggcatccgccaacaaattcgc
ttccagccctctttgcagcctgtggctagtgagcctgtgtgtccagatgtcgagatgccc
agcccctgggctccaagtggagactgtgccatggagtcacctcctccagcactaccacca
tgctctggccctgcccctgacactgttgatctgactctgcagcctgccccgcccgccagt
gagcttgctccgccaaaaagagagggtgccatctccgacaataccaaagcagccctcaaa
gctgctctgctcaagtccctgaggagccggcttcgagatgggcccagtgcacccttggag
gcccctgaacctcgaaagcctgtgacagctcaggaacgtcagcgagagcgagaagagaag
cgcaggaggcgacaagagagagccaaggagagggagaagcgacgacaagagcgggagcgc
aaggagaggggggctggcaccttggggggcccctctactgaccctttggctggattggtg
ctcagtgacaatgaccgaagcctgctagagcggtggactcgcatggctaggcctcctgtc
cctgcaccagcaccagcaccagcaccaacaccaaaaccaacaccaacaccaacacagtcc
tctgctcaacccactagtcctcccaatggccctgtatctcagtctactgctcctctacag
cctgcaggctctattcctggtcctgcctcccagcctgtttgcccaccccctgggcctgtt
ccccagcctgctggccctgtccctgcccctctccagactgccccttccactagccttttg
gcctcccagtcacttgtgccacctagtgggttgcctggttctggtgccccagaagttctg
ccttacttcccatctggcccaccacctccagatcctgggctcacccctcagccttctaca
tcagagtcacctgatgtcaacctggtgacccagcaactgtccaagtctcaggtggaggac
cccctgcctcccgtgttctcaggcactccaaagggcagtggggctggctacggtgttggc
tttgacctggaggaattcttaaaccaatcttttgacatgggtgtggctgatgggccacag
gatagccaggcagactcagcctcactctcagcctccctccttgctgactggcttgagggc
cacggcatgaaccccgctgacattgagtctctgcagcgtgagatccagatggactcccca
atgttgctgtctgacctgcctgacctccaagaaccctga

DBGET integrated database retrieval system