KEGG   Rattus norvegicus (rat): 114513Help
Entry
114513            CDS       T01003                                 

Gene name
Rasgrf2
Definition
RAS protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    114513 (Rasgrf2)
   04010 MAPK signaling pathway
    114513 (Rasgrf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q12-q14
AA seq 1190 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERTPAPPRTNAGPAGARDALDKQYYFTVLFGHEGQKPLELRCEEEQA
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIVALNKTKERMRPYHTHQEEEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARLANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEGNPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIQCTLIEEPDTSDDDT
KGPGHMFGHLDFKIVVEPPDAAPFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNNREHLVDGKSPRL
CRKFSSPPPLAVSRTSSPVRARKLSLTSSLNSRIGALDLTTSSSSSSPTTTVHSPAASPP
PHTAVPESAPADRAGDSTDMSPCRSPSTTPRHLRYRQPGGQVADSTHCAVSPASAFAIAT
AAAGHGSPPGFNNERTCDKEFIIRRTATNRVLNVLRHWVSKHSQDFELNNELKMNVLNLL
EEVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQMTDCPKAECFETLSAMELA
EQITLLDHIVFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNEMSNLVASQIMNYADI
SSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWTKVSKQTKALMDKLQ
KTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISH
IIREIRQFQQTAYRIDQQPKVIQYLLDKALVIDEDTLYELSLKIEPRLPA
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggccttcctggcgcgc
aaggagggcaccaagcgcggtttcctgagcaaaaaggctgccgaggcgagccgctggcac
gagaagtggttcgctctctatcagaatgtgctcttttacttcgaaggcgaacagagcggc
cgcccagcgggcatgtacctcctagagggctgcagctgtgagcggacgcccgccccacca
aggaccaacgcaggacccgcaggcgcccgggacgcgctggacaaacagtattacttcact
gtcctttttggtcacgaaggtcagaaaccactggagctgcgctgtgaggaggagcaagca
gggaaagagtggatggaggccattcaccaagccagttacgcagacattttgattgagagg
gaagtgttaatgcaaaagtacattcatctagttcagattgtggagacagaaaaaattgct
gctaaccaactccgacatcaactcgaagatcaagataccgaaattgaaagacttaaatca
gagattgttgctcttaataagaccaaggaacggatgcgcccgtatcatacccatcaagag
gaggaggatccagacatcaagaagatcaagaaggttcagagcttcatgagagggtggctg
tgcaggaggaagtggaagaccatcgttcaggactacatttgttccccccatgctgagagc
atgaggaagaggaaccagattgtcttcacgatggtggaggccgagtcagaatatgtgcac
cagctctacatcctggtgaacggtttcctcaggcctctgcgcatggcagccagctccaag
aagccccccattagccatgatgatgtcagcagcattttcctcaacagtgaaacaatcatg
tttcttcatgaaatattccatcaaggtctaaaggcaaggctggcaaattggcccactttg
gttttagctgatctctttgatattttgctgcctatgctcaacatttatcaagaatttgtg
cgtaatcatcagtacagcctccaagtacttgccaactgtaagcaaaatagagattttgac
aagctcttaaagcagtatgaaggcaaccctgcctgtgagggaaggatgctggagacattc
ttgacttacccaatgtttcagatccccaggtatatcatcacgctgcacgaactcctggct
cacaccccccatgaacacgtggagaggaaaagtctggagttcgctaagtcaaagctggag
gaactgtccagagtgatgcacgacgaagtcagtgacaccgaaaacatacggaaaaatctt
gccattgagaggatgatcgtggagggctgcgacattttgctagacaccagtcaaactttc
atccgacaaggttctcttatccaagtaccttctgtggagagggggaaactcagtaaagtc
cgcctgggctccctgtctttgaaaaaggaaggcgagagacaatgtttcttattcacgaag
cactttctgatctgtacccgaagttcaggaggaaagcttcatttgctcaagacaggtggg
gttctctccctcattcagtgtacgttgattgaggagccggacacaagtgatgatgacacc
aaaggtcctggtcacatgttcggacatctggattttaaaatcgtcgtggagcctcctgat
gctgccccgttcactgtggtcttgctagcaccttcgcgccaggagaaggctgcctggatg
agcgacatcagccagtgcgtggacaatatccgatgcaatggattgatgactatagtcttc
gaagagaattctaaagttactgtgccccatatgataaagtctgatgcccgtcttcataaa
gacgacactgacatctgtttcagtaaaacactcaattcctgcaaagtgccccagatccgc
tacgccagcgtggagcgcctcttggagcggttgacggatttgcggtttctgagcatcgat
ttcctcaacaccttcctgcacacctaccgcattttcaccacggctgccgtagtgctgggg
aagctctccgacatctacaagaggcctttcacctccattcctgtcagatcactagagtta
ttttttgccacgagccagaacaacagagaacatttggtcgatggaaaatccccacgtctt
tgtcgcaagttctcttccccacctcccctggctgtatccagaacgtcctccccagtgagg
gccagaaagctgtctttgacatcttccttgaactcaaggatcggagccttggacctgact
acatcctcatcttccagtagtcccaccaccactgtccacagtcctgctgcgtccccacca
cctcacactgctgtcccagagtctgcaccagccgaccgagcaggagactccacagacatg
tcaccttgtagatctccctcaaccactccccggcacctccgatatcgccagcctggagga
caggtagctgacagcacccactgtgctgtttcacctgcttctgcttttgcgatcgccaca
gcagcagcaggacatgggagtccgccaggatttaacaacgagaggacatgtgacaaggag
ttcatcatacggagaacagccaccaatcgagtcctgaatgtcctccgccactgggtttca
aagcactcacaggattttgaactcaataatgaactcaaaatgaatgttctgaacttgcta
gaagaagttctacgagacccggaccttcttcctcaagaaaggaaagccacggcgaacatc
ctgagggctctttcacaagatgatcaagatgacatccacctaaaattagaggatataatt
caaatgacagactgtccaaaggccgagtgctttgagacattgtcagccatggagctggct
gagcagatcactctcctggaccacattgttttcagaagcatcccctatgaagagtttctt
gggcagggctggatgaagctggataaaaacgaaaggactccttatatcatgaaaaccagc
cagcacttcaatgagatgagtaacctggtggcctcccagataatgaattatgctgacatc
agttcccgtgccaatgccattgagaagtgggtagcagtggcggacatctgccgatgtcta
cacaactacaatggtgtgctggagatcacctcggccttaaacagaagtgccatctacagg
ctgaagaaaacctggaccaaggtgtccaagcagacaaaagctctgatggacaaacttcag
aagactgtctcgtctgaaggaagatttaaaaacctcagagaaactctcaaaaactgtaac
cccccagctgtcccttaccttgggatgtacttgacagacctggcattcattgaagaaggg
acaccgaactttaccgaagaaggccttgtcaatttctccaaaatgcgaatgatatcacac
atcattcgtgagatacgccagttccagcagaccgcttaccgcatagaccagcagccaaag
gtcatacaatacctgcttgacaaagcccttgtcatagatgaagatacactctatgagctg
tcactcaaaattgaacctcgactccctgcttga

DBGET integrated database retrieval system