KEGG   Rattus norvegicus (rat): 116551Help
Entry
116551            CDS       T01003                                 

Gene name
Pdk1
Definition
pyruvate dehydrogenase kinase, isozyme 1 (EC:2.7.11.2)
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    116551 (Pdk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     116551 (Pdk1)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   116551 (Pdk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q22
AA seq 434 aa AA seqDB search
MRLARLLRGGTSVRPLCAVPCASRSLASDSASGSGPASESGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE
LLDFKDKSAEDAKTIYEFTDTVIRIRNRHNDVIPTMAQGVTEYKESFGVDPVTSQNVQYF
LDRFYMSRISIRMLLNQHSLLFGGKGSPSHRKHIGSINPNCDVVEVIKDGYENARRLCDL
YYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHADKGVYPPIQ
VHVTLGEEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPIS
RLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTESIERLPVYNKAAWKHYRTNHEADDWCV
PSREPKDMTTFRSS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcaaggctgctgcggggcggcacgagcgtcaggccgctctgtgccgtcccc
tgcgccagccgtagtctggcctcggactcggcctcgggctccgggccggcgtcggagagc
ggcgttccgggccaggtggacttctatgcgcgcttctcgccgtcgccactctccatgaag
cagttcctggacttcgggtcagtaaatgcttgtgaaaagacctcgttcatgtttcttcga
caagagttgcctgttagattggcaaatataatgaaagaaataagtctccttcccgataat
cttctcaggaccccatccgtacagctggtacaaagttggtatatccaaagccttcaggag
ctgcttgactttaaggacaagagtgctgaggatgctaaaactatttatgaattcacagac
acagtgataaggatcagaaaccggcacaatgatgtcatccccaccatggcccagggtgtg
actgaatacaaggagagcttcggggtggatcctgtcaccagccaaaatgttcagtacttt
ttggatcggttctacatgagtcgcatctcaattagaatgctactcaaccagcactcttta
ttgtttggtggaaaaggaagtccatctcatcgaaaacacattggaagcataaatccaaac
tgtgatgtagtcgaggttattaaagatggctatgagaatgcgagacggctttgtgatttg
tattacattaactctcctgaactagaacttgaagaactaaatgcgaaatcaccaggacag
ccaatacaagtggtttatgttccgtcccatctctatcacatggtgtttgaactgttcaag
aacgcaatgagggccaccatggagcaccatgcagacaaaggcgtttatcccccgattcaa
gttcacgtcacactgggggaggaggatttgactgtgaagatgagtgaccggggaggtggt
gttccgctgaggaagatcgacagactcttcaactacatgtactcaactgcaccccggcct
cgtgttgagacgtcccgtgcggtgcccctggctggatttggttacggattgcccatatca
cgcctctatgcacagtacttccagggagacctaaagctgtattccttagagggctacggg
acggatgctgtcatctatattaaggctctgtcaacggagtccatcgaaagactccctgtg
tataataaagctgcctggaagcattacagaaccaaccacgaggctgacgactggtgtgtg
cccagcagagagccgaaagacatgacgacgttccgaagctcgtaa

DBGET integrated database retrieval system