KEGG   Rattus norvegicus (rat): 116598Help
Entry
116598            CDS       T01003                                 

Gene name
Pdia4, ERp-72, Erp70, Erp72
Definition
protein disulfide isomerase family A, member 4 (EC:5.3.4.1)
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Protein processing in endoplasmic reticulum
Thyroid hormone synthesis
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:rno04141]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:rno04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q24
AA seq 643 aa AA seqDB search
MKLRKAWLLVLLLALTQLLAAASAEDAHEDASDSENPIEDDDEEEEDEEDEDDLEVKEEN
GVWVLNDENFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDA
TSASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVAKVREVSQPDWTPPPEVTLTL
TKENFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTD
LAKRFDVSGYPTLKIFRKGRPFDYNGPREKYGIVDYMVEQSGPPSKEILTLKQVQEFLKD
GDDVVILGVFQGVGDPGYLQYQDAANTLREDYKFHHTFSTEIAKFLKVSLGKLVLMQPEK
FQSKYEPRMHVMDVQGSTEASAIKDYVVKHDLPLVGHRKTSNDAKRYSKRPLVVVYYSVD
FSFDYRTATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKDLGLSESGEDVNAAILDES
GKKFAMEPEEFDSDALREFVMAFKKGKLKPVIKSQPVPKNNKGPVRVVVGKTFDAIVMDP
KKDVLIEFYAPWCGHCKQLEPVYTSLGKKYKGQKDLVIAKMDATANDITNDRYKVEGFPT
IYFAPSGDKKNPIKFEGGNRDLEHLSKFIDEHATKRSRTKEEL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccggaaagcttggctgttggtcctgctcttggcgctgacacagctgctggct
gctgcgagcgccgaagatgcgcacgaagatgcttcagattcagaaaatcccattgaggat
gacgacgaggaggaggaagatgaagaagatgaagatgacttggaagttaaggaagaaaat
ggtgtttgggtcctaaacgatgaaaacttcgataactttgtggctgacaaagatacagtg
ctcctggagttctatgcaccgtggtgtggacactgcaagcaatttgctccagaatatgag
aaaattgccagtactttgaaggataatgatcctcccattgctgttgcaaagattgacgcg
acctcagcatccatgttggccagcaaattcgatgtgagtggctaccccaccatcaagatc
ctgaagaagggacaggctgttgactatgacggctccaggacccaggaagaaattgttgcc
aaagtcagagaagtttcccagcctgattggacacctccacctgaagtcactcttacattg
actaaagagaactttgacgatgttgtaaataatgcagacatcattttggtggagttctat
gccccatggtgcggacactgcaagaaacttgcccctgagtatgagaaggctgccaaggag
ctcagcaagcgctctcccccaattcccttagccaaagttgatgccaccgaacagacagac
ctggctaagaggtttgatgtctctggctaccccactttgaaaatattccgcaaaggaagg
ccttttgactacaatggtccacgagagaaatatggaattgttgactacatggttgagcag
tctggacctccttccaaggagattctgaccctgaagcaggtccaggagtttctgaaggat
ggagatgatgtagtcatccttggagtctttcagggagtcggtgacccaggctacttgcag
tatcaggatgctgctaacaccctgagagaagattacaaatttcaccacactttcagcact
gaaatagctaagttcctgaaagtctccctggggaaactggtgctgatgcagcctgagaag
ttccagtccaagtatgagcccaggatgcatgtgatggatgttcagggctccacagaggca
tcagccattaaggactatgtggtgaaacatgacttgcccctagtgggccacaggaagact
tctaacgatgctaagcggtacagcaagcgccccctggtggttgtatactacagcgtggac
ttcagctttgattacagaactgctactcagttttggcgtaacaaagtcctagaggtggcc
aaggacttccctgagtacacattcgccattgctgatgaagaagactatgccacagaggtg
aaggacctgggactgagtgagagtggagaggacgtcaatgcagccatcctagatgagagt
gggaagaagtttgccatggagccagaggagtttgattcagatgctctccgagaatttgtc
atggctttcaaaaaaggaaaactaaagccagttatcaaatcacagccagttcccaagaac
aacaagggaccagtcagggtggtagtggggaagacctttgatgccattgtgatggacccc
aaaaaggacgtcctcattgaattctatgcaccgtggtgtgggcactgcaagcagctggag
cctgtctacaccagcctaggcaagaagtacaagggccagaaggacttggtcatcgccaag
atggatgctactgccaatgacatcaccaacgaccgatacaaggtggagggcttccccacc
atctattttgcccccagtggggacaaaaagaacccaattaagtttgagggtggcaacaga
gatctggagcatttgagcaagtttatcgatgaacatgccacaaagaggagcaggaccaag
gaagagctttaa

DBGET integrated database retrieval system