KEGG   Rattus norvegicus (rat): 116598Help
Entry
116598            CDS       T01003                                 

Gene name
Pdia4, ERp-72, Erp70, Erp72
Definition
protein disulfide isomerase family A, member 4 (EC:5.3.4.1)
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Protein processing in endoplasmic reticulum
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    116598 (Pdia4)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    116598 (Pdia4)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     116598 (Pdia4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q24
AA seq 643 aa AA seqDB search
MKLRKAWLLVLLLALTQLLAAASAEDAHEDASDSENPIEDDDEEEEDEEDEDDLEVKEEN
GVWVLNDENFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDA
TSASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVAKVREVSQPDWTPPPEVTLTL
TKENFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTD
LAKRFDVSGYPTLKIFRKGRPFDYNGPREKYGIVDYMVEQSGPPSKEILTLKQVQEFLKD
GDDVVILGVFQGVGDPGYLQYQDAANTLREDYKFHHTFSTEIAKFLKVSLGKLVLMQPEK
FQSKYEPRMHVMDVQGSTEASAIKDYVVKHDLPLVGHRKTSNDAKRYSKRPLVVVYYSVD
FSFDYRTATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKDLGLSESGEDVNAAILDES
GKKFAMEPEEFDSDALREFVMAFKKGKLKPVIKSQPVPKNNKGPVRVVVGKTFDAIVMDP
KKDVLIEFYAPWCGHCKQLEPVYTSLGKKYKGQKDLVIAKMDATANDITNDRYKVEGFPT
IYFAPSGDKKNPIKFEGGNRDLEHLSKFIDEHATKRSRTKEEL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccggaaagcttggctgttggtcctgctcttggcgctgacacagctgctggct
gctgcgagcgccgaagatgcgcacgaagatgcttcagattcagaaaatcccattgaggat
gacgacgaggaggaggaagatgaagaagatgaagatgacttggaagttaaggaagaaaat
ggtgtttgggtcctaaacgatgaaaacttcgataactttgtggctgacaaagatacagtg
ctcctggagttctatgcaccgtggtgtggacactgcaagcaatttgctccagaatatgag
aaaattgccagtactttgaaggataatgatcctcccattgctgttgcaaagattgacgcg
acctcagcatccatgttggccagcaaattcgatgtgagtggctaccccaccatcaagatc
ctgaagaagggacaggctgttgactatgacggctccaggacccaggaagaaattgttgcc
aaagtcagagaagtttcccagcctgattggacacctccacctgaagtcactcttacattg
actaaagagaactttgacgatgttgtaaataatgcagacatcattttggtggagttctat
gccccatggtgcggacactgcaagaaacttgcccctgagtatgagaaggctgccaaggag
ctcagcaagcgctctcccccaattcccttagccaaagttgatgccaccgaacagacagac
ctggctaagaggtttgatgtctctggctaccccactttgaaaatattccgcaaaggaagg
ccttttgactacaatggtccacgagagaaatatggaattgttgactacatggttgagcag
tctggacctccttccaaggagattctgaccctgaagcaggtccaggagtttctgaaggat
ggagatgatgtagtcatccttggagtctttcagggagtcggtgacccaggctacttgcag
tatcaggatgctgctaacaccctgagagaagattacaaatttcaccacactttcagcact
gaaatagctaagttcctgaaagtctccctggggaaactggtgctgatgcagcctgagaag
ttccagtccaagtatgagcccaggatgcatgtgatggatgttcagggctccacagaggca
tcagccattaaggactatgtggtgaaacatgacttgcccctagtgggccacaggaagact
tctaacgatgctaagcggtacagcaagcgccccctggtggttgtatactacagcgtggac
ttcagctttgattacagaactgctactcagttttggcgtaacaaagtcctagaggtggcc
aaggacttccctgagtacacattcgccattgctgatgaagaagactatgccacagaggtg
aaggacctgggactgagtgagagtggagaggacgtcaatgcagccatcctagatgagagt
gggaagaagtttgccatggagccagaggagtttgattcagatgctctccgagaatttgtc
atggctttcaaaaaaggaaaactaaagccagttatcaaatcacagccagttcccaagaac
aacaagggaccagtcagggtggtagtggggaagacctttgatgccattgtgatggacccc
aaaaaggacgtcctcattgaattctatgcaccgtggtgtgggcactgcaagcagctggag
cctgtctacaccagcctaggcaagaagtacaagggccagaaggacttggtcatcgccaag
atggatgctactgccaatgacatcaccaacgaccgatacaaggtggagggcttccccacc
atctattttgcccccagtggggacaaaaagaacccaattaagtttgagggtggcaacaga
gatctggagcatttgagcaagtttatcgatgaacatgccacaaagaggagcaggaccaag
gaagagctttaa

DBGET integrated database retrieval system