KEGG   Rattus norvegicus (rat): 117036Help
Entry
117036            CDS       T01003                                 

Gene name
Lamc1, B2e
Definition
laminin, gamma 1
Orthology
K05635  
laminin, gamma 1
Organism
rno  Rattus norvegicus (rat)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    117036 (Lamc1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    117036 (Lamc1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    117036 (Lamc1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    117036 (Lamc1)
   05222 Small cell lung cancer
    117036 (Lamc1)
  Neurodegenerative diseases
   05020 Prion diseases
    117036 (Lamc1)
  Infectious diseases
   05146 Amoebiasis
    117036 (Lamc1)
   05145 Toxoplasmosis
    117036 (Lamc1)
Cell adhesion molecules and their ligands [BR:rno04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      117036 (Lamc1)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      117036 (Lamc1)
     Laminin-2 Extracellular matrix (ECM) components
      117036 (Lamc1)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      117036 (Lamc1)
   VLA-3
      117036 (Lamc1)
     Laminin-10 Extracellular matrix (ECM) components
      117036 (Lamc1)
     Laminin-11 Extracellular matrix (ECM) components
      117036 (Lamc1)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      117036 (Lamc1)
     Laminin-8 Extracellular matrix (ECM) components
      117036 (Lamc1)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      117036 (Lamc1)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      117036 (Lamc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
13q21
AA seq 1607 aa AA seqDB search
MTGGRRAALALQLQRRLWLLLAVLAAVACWVRAAMDECADEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQLHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFGK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESANQCLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVEGFSCERCKPGFF
NLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSTFQIDEDGWRVEQRDGSEASLEWSS
DRQDIAVISDTYFPRYFVAPAKFLGNQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLQSARPGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCA
IVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVT
GQCQCLPHVSGRDCGACDPGFYNLQSGQGCESCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELESLIANLGTGDETVTDQAFEDRLKEAEREV
TDLLREAQEVKDVDQNLMDRLQRVNNSLHSQISRLHNIRNTIEETGILAERARSRVESTE
QLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARRLAERHKQEADDIVRVAK
TANETSAEAYNLLLRTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALESEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVK
NLLEKGKAEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINRTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASGVQKNATS
TKADAERTFSEVTDLDNEVNGMLRQLEEAENELKRKQDDADQDMMMAGMASQAAQEAELN
ARKAKNSVSSLLSQLTDLLEQLGQLDTVDLNKLNEIEGSLNKAKDEMKVSDLDRKVSNLE
NEARKQEAAILDYDRDIAEIIKDIHNLEDIKKTLPTGCFNTPSIEKP
NT seq 4824 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcggcaggcgggccgctctggccctgcagctccagcggcggctgtggctgctg
ctggctgtgctggcggccgtggcgtgctgggtccgggcggccatggacgagtgcgcggat
gagggcggccggccgcagcgctgcatgccggagtttgttaatgccgccttcaatgtgacc
gtggtggctaccaacacgtgtgggactccacccgaggagtactgcgtgcagactggagtg
accggagtcaccaagtcctgtcacctgtgcgacgccggccagctccacctgcaacacggg
gcagccttcttgaccgactacaacaaccaggccgacaccacctggtggcaaagccagact
atgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaggct
tttgacatcacttacgtgcgtctcaagttccacaccagccgcccagagagtttcgccatt
tataagcgcactcgggaagacgggccctggattccttaccagtactacagtggctcctgt
gagaacacgtactcaaaggctaaccgtggcttcatcaggacgggaggagatgagcagcag
gccttgtgtaccgatgagttcagtgacatttcccccctcaccggcggcaacgtggccttt
tcaactctggaaggaaggccgagtgcctacaactttgacaacagccccgtgctacaggaa
tgggtgacagccactgacatcagagtcacactcaatcgcctgaacacctttggagatgaa
gtattcaatgaccccaaagtcctcaagtcttactattatgcaatctcggactttgctgtg
ggtggcaggtgtaaatgtaatggacatgccagtgagtgtgtaaagaacgagtttgggaag
ctcgtgtgcaactgcaagcataacacatacggagttgactgtgaaaagtgcctgcctttc
ttcaacgatcggccgtggaggagagcaactgccgagagtgccaaccagtgcctgccttgc
gactgcaatggccgatcccaagaatgctactttgaccctgagctataccgttccactggg
cacggtggccactgtaccaactgccgggataacacagacggtgccaagtgcgagaggtgc
cgggagaacttcttccgcctggggaacactgaagcctgctctccgtgccactgcagcccc
gttggttctctcagcacgcagtgtgacagttacggcaggtgcagctgtaagcccggagtg
atgggtgacaagtgtgaccgttgccagcctgggttccattccctcaccgaggcaggatgc
aggccatgctcctgcgacccttctggcagcaccgacgaatgtaatgttgaaacaggaaga
tgcgtttgcaaagacaacgtcgaaggcttcagctgtgagagatgcaaacctggatttttt
aatctggaatcctccaatcctaagggttgcacaccctgcttctgctttgggcattcttct
gtgtgcaccaatgctgttggctacagtgtttatgacatctcctcgacctttcagattgat
gaggacgggtggcgtgtggagcagagagatggctcggaggcgtctcttgagtggtcctca
gaccggcaggatattgctgtgatctcagacacttacttccccagatactttgtcgcccct
gccaagttcctgggcaaccaggtcctgagttacgggcagaacctctcattctccttccga
gtggacagacgggacactcgcctctccgcagaggatctcgtgctggaaggagctggcttg
agagtatccgtgcccttgatcgctcagggcaactcgtaccctagcgagaccactgtgaag
tacatcttcagactccatgaagcaacagattacccttggaggcctgctctctccccattt
gaatttcagaagctcctaaacaacttgacctctatcaagatccgtggtacatacagtgag
aggagcgctggatatttggatgatgtcaccttgcaaagtgctcgccctgggcccggagtc
cccgcaacgtgggtggagtcctgcacctgtccagtggggtatggagggcagttctgtgag
acatgcctcccaggctacagaagagaaaccccaagtcttggaccttacagcccgtgtgtg
ctctgtacctgtaatgggcacagtgagacctgtgaccccgagacaggtgtctgtgactgc
agagacaatactgccggcccgcactgtgagaaatgtagcgatgggtactatggagactca
accctgggcacctcctctgactgccagccttgtccctgccctggcggctcaagttgtgcc
attgtcccaaagacaaaggaagtggtgtgcacacactgtccaactggcactgccggcaag
agatgtgagctctgtgatgacggctactttggagaccctctgggcagcaatggacccgtg
agactctgccgcccatgtcagtgcaacgacaacatagaccccaacgcagttggcaactgc
aaccgtctgactggagaatgcctgaagtgcatctataacacggctggcttctactgcgac
cggtgcaaagaagggtttttcggaaatcccctggctcccaatccagcagacaagtgcaaa
gcctgcgcctgcaatccctatggtacagtacagcagcagagcagctgtaacccagtgacc
gggcagtgccagtgtctgcctcatgtgtcaggccgggactgtggcgcttgtgaccctggc
ttctacaacctgcagagcgggcaaggctgcgagagttgtgactgccatgctttgggctcc
accaacgggcaatgtgacatccgcaccgggcagtgtgagtgtcagcccggcatcaccggt
cagcactgtgagcgctgtgagaccaaccactttgggtttggacctgaaggctgcaaacct
tgcgactgtcaccacgaaggatccctttcgctccaatgtaaggatgacggccgttgtgaa
tgcagggaaggcttcgtgggcaatcgctgtgaccagtgtgaagagaactatttctacaat
cggtcttggcctggctgccaagagtgtccggcttgttaccggctggtgaaggataaggtt
gctgagcatcgagtgaaactccaggagttggagagcctcatagcaaacctcgggactggg
gatgagacggtgacagatcaagcctttgaggacagactgaaggaagcagagagggaggtt
acagacctcctccgtgaggctcaggaagtcaaagatgtagaccaaaatctgatggatcgc
cttcagagagtaaataacagtctgcacagccaaatcagccggctgcacaatatccggaac
actatagaagagacggggatcttggctgagcgagcgcggtcccgagtggagagcacagag
cagctgattgagatcgcctccagggagctcgagaaagcaaaaatggctgccgccaatgtg
tcaatcactcagccagagtctacaggggaaccaaacaacatgaccctcttggcagaagaa
gcccgaaggcttgcagagcgtcataaacaggaagctgatgacattgtacgagtggcaaag
acagccaacgagacctcagctgaggcatataatctgcttttgaggaccctggcaggagaa
aatcaaactgcattggagattgaagagcttaacaggaagtatgaacaagcaaagaacatc
tctcaggacctggagaagcaggctgccagagtccatgaggaagccaagcgagcaggtgac
aaagccgtggagatctatgccagtgtggcccagctgacccctgtggactcggaggctcta
gagagtgaagcaaataaaatcaagaaagaagctgcagatctggaccgtctgattgaccag
aagctaaaagattacgaggaccttagggaagacatgcgaggaaaggaacatgaagtaaag
aaccttctagagaaggggaaagccgaacagcagaccgctgaccaactcctagctcgagcc
gacgctgccaaggctcttgctgaagaagctgctaaaaagggacgcaataccttacaagaa
gctaacgacattctcaacaacctgaaagattttgatagacgagtgaacgataacaagaca
gctgctgaagaagctctaaggagaattcccgccatcaaccggaccatagctgaagccaat
gagaagacaagggaggcacagctggcgctgggcaatgcagcagctgacgccacggaggcc
aagaacaaagcccacgaggcggagaggattgccagtggcgtgcagaagaatgccaccagt
accaaggcggatgcggagagaaccttctcggaagtgacagacctggataacgaggtgaat
ggcatgttgaggcagctagaggaagcggagaatgagctgaagaggaagcaagatgatgcc
gaccaggacatgatgatggcgggaatggcttcacaggctgctcaggaagctgaacttaat
gccagaaaagccaaaaactctgtcagcagcctcctcagccaactgaccgacctcttggag
cagctgggacagctggacaccgtggacctgaacaagctcaacgagatcgaaggctctctg
aacaaagccaaagacgaaatgaaggtgagcgacctggacaggaaggtgtccaacctggag
aacgaggcccggaagcaggaggcagccatcttggactatgaccgagacatagcagagatc
ataaaggacattcacaacctggaggacatcaagaagacactaccaacaggctgctttaac
accccgtccatcgagaaaccctag

DBGET integrated database retrieval system