KEGG   Rattus norvegicus (rat): 117036Help
Entry
117036            CDS       T01003                                 

Gene name
Lamc1, B2e
Definition
laminin, gamma 1
Orthology
K05635  
laminin, gamma 1
Organism
rno  Rattus norvegicus (rat)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:rno04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:rno04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:rno04510]
Human Diseases; Cancers; Pathways in cancer [PATH:rno05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:rno05222]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:rno05020]
Human Diseases; Infectious diseases; Amoebiasis [PATH:rno05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:rno05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
13q21
AA seq 1607 aa AA seqDB search
MTGGRRAALALQLQRRLWLLLAVLAAVACWVRAAMDECADEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQLHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFGK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESANQCLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVEGFSCERCKPGFF
NLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSTFQIDEDGWRVEQRDGSEASLEWSS
DRQDIAVISDTYFPRYFVAPAKFLGNQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLQSARPGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCA
IVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVT
GQCQCLPHVSGRDCGACDPGFYNLQSGQGCESCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELESLIANLGTGDETVTDQAFEDRLKEAEREV
TDLLREAQEVKDVDQNLMDRLQRVNNSLHSQISRLHNIRNTIEETGILAERARSRVESTE
QLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARRLAERHKQEADDIVRVAK
TANETSAEAYNLLLRTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALESEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVK
NLLEKGKAEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINRTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASGVQKNATS
TKADAERTFSEVTDLDNEVNGMLRQLEEAENELKRKQDDADQDMMMAGMASQAAQEAELN
ARKAKNSVSSLLSQLTDLLEQLGQLDTVDLNKLNEIEGSLNKAKDEMKVSDLDRKVSNLE
NEARKQEAAILDYDRDIAEIIKDIHNLEDIKKTLPTGCFNTPSIEKP
NT seq 4824 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcggcaggcgggccgctctggccctgcagctccagcggcggctgtggctgctg
ctggctgtgctggcggccgtggcgtgctgggtccgggcggccatggacgagtgcgcggat
gagggcggccggccgcagcgctgcatgccggagtttgttaatgccgccttcaatgtgacc
gtggtggctaccaacacgtgtgggactccacccgaggagtactgcgtgcagactggagtg
accggagtcaccaagtcctgtcacctgtgcgacgccggccagctccacctgcaacacggg
gcagccttcttgaccgactacaacaaccaggccgacaccacctggtggcaaagccagact
atgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaggct
tttgacatcacttacgtgcgtctcaagttccacaccagccgcccagagagtttcgccatt
tataagcgcactcgggaagacgggccctggattccttaccagtactacagtggctcctgt
gagaacacgtactcaaaggctaaccgtggcttcatcaggacgggaggagatgagcagcag
gccttgtgtaccgatgagttcagtgacatttcccccctcaccggcggcaacgtggccttt
tcaactctggaaggaaggccgagtgcctacaactttgacaacagccccgtgctacaggaa
tgggtgacagccactgacatcagagtcacactcaatcgcctgaacacctttggagatgaa
gtattcaatgaccccaaagtcctcaagtcttactattatgcaatctcggactttgctgtg
ggtggcaggtgtaaatgtaatggacatgccagtgagtgtgtaaagaacgagtttgggaag
ctcgtgtgcaactgcaagcataacacatacggagttgactgtgaaaagtgcctgcctttc
ttcaacgatcggccgtggaggagagcaactgccgagagtgccaaccagtgcctgccttgc
gactgcaatggccgatcccaagaatgctactttgaccctgagctataccgttccactggg
cacggtggccactgtaccaactgccgggataacacagacggtgccaagtgcgagaggtgc
cgggagaacttcttccgcctggggaacactgaagcctgctctccgtgccactgcagcccc
gttggttctctcagcacgcagtgtgacagttacggcaggtgcagctgtaagcccggagtg
atgggtgacaagtgtgaccgttgccagcctgggttccattccctcaccgaggcaggatgc
aggccatgctcctgcgacccttctggcagcaccgacgaatgtaatgttgaaacaggaaga
tgcgtttgcaaagacaacgtcgaaggcttcagctgtgagagatgcaaacctggatttttt
aatctggaatcctccaatcctaagggttgcacaccctgcttctgctttgggcattcttct
gtgtgcaccaatgctgttggctacagtgtttatgacatctcctcgacctttcagattgat
gaggacgggtggcgtgtggagcagagagatggctcggaggcgtctcttgagtggtcctca
gaccggcaggatattgctgtgatctcagacacttacttccccagatactttgtcgcccct
gccaagttcctgggcaaccaggtcctgagttacgggcagaacctctcattctccttccga
gtggacagacgggacactcgcctctccgcagaggatctcgtgctggaaggagctggcttg
agagtatccgtgcccttgatcgctcagggcaactcgtaccctagcgagaccactgtgaag
tacatcttcagactccatgaagcaacagattacccttggaggcctgctctctccccattt
gaatttcagaagctcctaaacaacttgacctctatcaagatccgtggtacatacagtgag
aggagcgctggatatttggatgatgtcaccttgcaaagtgctcgccctgggcccggagtc
cccgcaacgtgggtggagtcctgcacctgtccagtggggtatggagggcagttctgtgag
acatgcctcccaggctacagaagagaaaccccaagtcttggaccttacagcccgtgtgtg
ctctgtacctgtaatgggcacagtgagacctgtgaccccgagacaggtgtctgtgactgc
agagacaatactgccggcccgcactgtgagaaatgtagcgatgggtactatggagactca
accctgggcacctcctctgactgccagccttgtccctgccctggcggctcaagttgtgcc
attgtcccaaagacaaaggaagtggtgtgcacacactgtccaactggcactgccggcaag
agatgtgagctctgtgatgacggctactttggagaccctctgggcagcaatggacccgtg
agactctgccgcccatgtcagtgcaacgacaacatagaccccaacgcagttggcaactgc
aaccgtctgactggagaatgcctgaagtgcatctataacacggctggcttctactgcgac
cggtgcaaagaagggtttttcggaaatcccctggctcccaatccagcagacaagtgcaaa
gcctgcgcctgcaatccctatggtacagtacagcagcagagcagctgtaacccagtgacc
gggcagtgccagtgtctgcctcatgtgtcaggccgggactgtggcgcttgtgaccctggc
ttctacaacctgcagagcgggcaaggctgcgagagttgtgactgccatgctttgggctcc
accaacgggcaatgtgacatccgcaccgggcagtgtgagtgtcagcccggcatcaccggt
cagcactgtgagcgctgtgagaccaaccactttgggtttggacctgaaggctgcaaacct
tgcgactgtcaccacgaaggatccctttcgctccaatgtaaggatgacggccgttgtgaa
tgcagggaaggcttcgtgggcaatcgctgtgaccagtgtgaagagaactatttctacaat
cggtcttggcctggctgccaagagtgtccggcttgttaccggctggtgaaggataaggtt
gctgagcatcgagtgaaactccaggagttggagagcctcatagcaaacctcgggactggg
gatgagacggtgacagatcaagcctttgaggacagactgaaggaagcagagagggaggtt
acagacctcctccgtgaggctcaggaagtcaaagatgtagaccaaaatctgatggatcgc
cttcagagagtaaataacagtctgcacagccaaatcagccggctgcacaatatccggaac
actatagaagagacggggatcttggctgagcgagcgcggtcccgagtggagagcacagag
cagctgattgagatcgcctccagggagctcgagaaagcaaaaatggctgccgccaatgtg
tcaatcactcagccagagtctacaggggaaccaaacaacatgaccctcttggcagaagaa
gcccgaaggcttgcagagcgtcataaacaggaagctgatgacattgtacgagtggcaaag
acagccaacgagacctcagctgaggcatataatctgcttttgaggaccctggcaggagaa
aatcaaactgcattggagattgaagagcttaacaggaagtatgaacaagcaaagaacatc
tctcaggacctggagaagcaggctgccagagtccatgaggaagccaagcgagcaggtgac
aaagccgtggagatctatgccagtgtggcccagctgacccctgtggactcggaggctcta
gagagtgaagcaaataaaatcaagaaagaagctgcagatctggaccgtctgattgaccag
aagctaaaagattacgaggaccttagggaagacatgcgaggaaaggaacatgaagtaaag
aaccttctagagaaggggaaagccgaacagcagaccgctgaccaactcctagctcgagcc
gacgctgccaaggctcttgctgaagaagctgctaaaaagggacgcaataccttacaagaa
gctaacgacattctcaacaacctgaaagattttgatagacgagtgaacgataacaagaca
gctgctgaagaagctctaaggagaattcccgccatcaaccggaccatagctgaagccaat
gagaagacaagggaggcacagctggcgctgggcaatgcagcagctgacgccacggaggcc
aagaacaaagcccacgaggcggagaggattgccagtggcgtgcagaagaatgccaccagt
accaaggcggatgcggagagaaccttctcggaagtgacagacctggataacgaggtgaat
ggcatgttgaggcagctagaggaagcggagaatgagctgaagaggaagcaagatgatgcc
gaccaggacatgatgatggcgggaatggcttcacaggctgctcaggaagctgaacttaat
gccagaaaagccaaaaactctgtcagcagcctcctcagccaactgaccgacctcttggag
cagctgggacagctggacaccgtggacctgaacaagctcaacgagatcgaaggctctctg
aacaaagccaaagacgaaatgaaggtgagcgacctggacaggaaggtgtccaacctggag
aacgaggcccggaagcaggaggcagccatcttggactatgaccgagacatagcagagatc
ataaaggacattcacaacctggaggacatcaagaagacactaccaacaggctgctttaac
accccgtccatcgagaaaccctag

DBGET integrated database retrieval system