KEGG   Rattus norvegicus (rat): 117559Help
Entry
117559            CDS       T01003                                 

Gene name
Sv2a, Sv2
Definition
(RefSeq) synaptic vesicle glycoprotein 2a
  KO
K06258  
MFS transporter, VNT family, synaptic vesicle glycoprotein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    117559 (Sv2a)
Transporters [BR:rno02000]
 Major Facilitator Superfamily (MFS)
  Protein transporters
   Vesicular neurotransmitter transporter (VNT) [TC:2.A.1.22]
    117559 (Sv2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q34
AA seq 742 aa AA seqDB search
MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEEDDDDFPA
PADGYYRGEGAQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLA
GVRGGLSDGEGPPGGRGEAQRRKDREELAQQYETILRECGHGRFQWTLYFVLGLALMADG
VEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS
VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW
MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRF
FLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW
GVRALSLGGQVWGNFLSCFSPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY
AARTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVT
SSNTFFRNCTFINTVFYNTDLFEYKFVNSRLVNSTFLHNKEGCPLDVTGTGEGAYMVYFV
SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVLSCVSCFFLSFGNSESAMIALLCLFGG
VSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS
AALALGSSLALKLPETRGQVLQ
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggctttcgagaccgagcagcgttcatccgtggggccaaagacattgccaag
gaagttaagaagcacgcggccaagaaggtggtgaagggtctcgacagagtccaggatgaa
tattcccgaaggtcctactcccgctttgaggaggaggaggatgatgatgacttccctgcc
cctgctgacggctattaccgcggagaaggggcccaggatgaggaggaaggtggcgcttcc
agtgatgccactgagggccacgatgaggatgatgagatctacgagggagaatatcagggc
atcccccgggcagagtctgggggcaaaggcgaacggatggcagatggggcacccctggct
ggagtgagagggggcttaagtgatggggagggtccccctgggggtcgcggggaggcgcag
cggcgtaaagatcgggaagaattggctcagcagtatgagaccatcctccgggagtgcggc
catggtcgcttccagtggacactctacttcgtgctgggtctggcgctgatggccgatggt
gtagaggtctttgtggtgggctttgtgctgcccagtgctgagaaagatatgtgcctgtcg
gactccaacaaaggcatgctaggcctcattgtgtacctgggcatgatggtgggggccttc
ctctggggaggcctggctgatcggctgggtcggagacagtgtctgctcatctcgctctca
gtcaacagcgtcttcgctttcttctcatccttcgtccagggttatggcaccttccttttc
tgccgcctcctttctggggttgggattggtggttccatccccattgtcttctcctatttt
tcggagtttctggcccaggagaaacgtggggagcatttgagctggctctgtatgttctgg
atgattggtggcgtgtatgcagctgcaatggcctgggccatcatcccccactatgggtgg
agtttccagatgggctctgcttaccagttccacagctggagggtctttgtcctcgtctgt
gcctttccctctgtgtttgccatcggggctctgactacgcagccggagagtccccgcttc
ttcttagagaatgggaagcacgatgaggcctggatggtgctgaagcaggttcatgacacc
aacatgcgagccaagggccatcctgagcgagtcttctcagtaacccacattaaaacgatt
catcaggaggatgaattgattgagatccagtcagacacaggaacctggtaccagcgctgg
ggagtgcgggctttgagcctggggggtcaggtttgggggaacttcctctcctgcttcagt
ccagagtaccggcgcatcactctgatgatgatgggggtatggttcaccatgtccttcagc
tactacggtttgactgtctggtttcccgacatgatccgccatctccaggctgtggactat
gcagcccgaaccaaagtgttcccaggggagcgcgtggagcacgtgacatttaacttcaca
ctggagaatcagatccaccgagggggacagtacttcaatgacaagttcatcgggctgcgt
ctgaagtcagtgtcctttgaggattccctgtttgaggaatgttactttgaagatgtcaca
tccagcaacacattcttccgcaactgcacattcatcaacaccgtgttctacaacacggac
ctgtttgagtacaagttcgtgaacagccgcctggtgaacagcacattcctgcacaataag
gaaggttgcccactagatgtgacagggacgggcgaaggtgcctacatggtgtactttgtc
agcttcttggggacactggctgtgctccctggaaatattgtgtctgctctgctcatggac
aagattggcaggctcagaatgcttgctggttccagtgtgttgtcctgtgtttcctgcttc
ttcctgtcttttgggaacagtgagtcagccatgatcgctctgctctgcctttttggggga
gtcagtattgcatcctggaacgcgctggacgtgctgactgttgaactctacccttccgac
aagaggacgacggccttcggcttcctgaatgccctgtgtaagctggcagctgtactgggc
atcagcatcttcacgtcctttgtgggaatcaccaaggccgctcccatcctcttcgcctca
gctgcgcttgcccttggtagctctctggctctgaagctgcctgagacccggggacaggtg
ctgcagtga

DBGET integrated database retrieval system