KEGG   Rattus norvegicus (rat): 140547Help
Entry
140547            CDS       T01003                                 

Gene name
Echs1
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    140547 (Echs1)
   01212 Fatty acid metabolism
    140547 (Echs1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    140547 (Echs1)
   00650 Butanoate metabolism
    140547 (Echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    140547 (Echs1)
   00071 Fatty acid degradation
    140547 (Echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    140547 (Echs1)
   00310 Lysine degradation
    140547 (Echs1)
   00380 Tryptophan metabolism
    140547 (Echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    140547 (Echs1)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     140547 (Echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q41
AA seq 290 aa AA seqDB search
MAALRALLPRACNSLLSPVRCPEFRRFASGANFQYIITEKKGKNSSVGLIQLNRPKALNA
LCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHW
DHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMA
KESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctgcgtgctctgctgcccagagcctgcaactcgctgttgtccccagttcgc
tgcccagaattccggcgcttcgcctcgggtgctaactttcagtacatcatcacggaaaag
aaaggaaagaatagcagcgtggggctgatccagttgaaccgtcccaaagcactcaatgca
ctttgcaatggactgattgaggagctcaaccaagcactggagacctttgaggaagatccc
gctgtgggcgccattgtgctcactggtggggagaaggcctttgcagccggagctgacatc
aaggaaatgcagaaccggacatttcaggactgttactcaggcaagttcctgagccactgg
gaccatatcacccggatcaagaaaccggtcatcgcggctgtcaatggctatgctcttggt
gggggctgtgaacttgccatgatgtgcgatatcatctatgctggtgagaaagcccagttt
ggacagccagaaatcctcctggggaccatcccaggtgcagggggcactcagagactcacc
cgagcagtcggcaaatcactagcaatggagatggtcctcactggtgaccgaatttcagca
caggatgccaagcaagcaggtcttgtaagcaagatttttcccgttgaaacactggttgaa
gaggccatccaatgtgcagaaaagatcgccaacaattccaagatcatagtagccatggcg
aaagaatctgtgaatgcagcctttgaaatgacgttaacagaaggaaataagctggagaag
aagctcttctattccacctttgccactgatgaccggagagaagggatgtctgcctttgtg
gagaaaaggaaggccaacttcaaagaccactga

DBGET integrated database retrieval system