KEGG   Rattus norvegicus (rat): 140547Help
Entry
140547            CDS       T01003                                 

Gene name
Echs1
Definition
(RefSeq) enoyl CoA hydratase, short chain, 1, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00062  Fatty acid elongation
rno00071  Fatty acid degradation
rno00280  Valine, leucine and isoleucine degradation
rno00310  Lysine degradation
rno00380  Tryptophan metabolism
rno00410  beta-Alanine metabolism
rno00640  Propanoate metabolism
rno00650  Butanoate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01212  Fatty acid metabolism
Module
rno_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
rno_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
rno_M00085  Fatty acid biosynthesis, elongation, mitochondria
rno_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    140547 (Echs1)
   00650 Butanoate metabolism
    140547 (Echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    140547 (Echs1)
   00071 Fatty acid degradation
    140547 (Echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    140547 (Echs1)
   00310 Lysine degradation
    140547 (Echs1)
   00380 Tryptophan metabolism
    140547 (Echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    140547 (Echs1)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     140547 (Echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 140547
NCBI-ProteinID: NP_511178
RGD: 69330
Ensembl: ENSRNOG00000018522
UniProt: P14604
Structure
PDB: 

Jmol
Position
1q41
AA seq 290 aa AA seqDB search
MAALRALLPRACNSLLSPVRCPEFRRFASGANFQYIITEKKGKNSSVGLIQLNRPKALNA
LCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHW
DHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMA
KESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctgcgtgctctgctgcccagagcctgcaactcgctgttgtccccagttcgc
tgcccagaattccggcgcttcgcctcgggtgctaactttcagtacatcatcacggaaaag
aaaggaaagaatagcagcgtggggctgatccagttgaaccgtcccaaagcactcaatgca
ctttgcaatggactgattgaggagctcaaccaagcactggagacctttgaggaagatccc
gctgtgggcgccattgtgctcactggtggggagaaggcctttgcagccggagctgacatc
aaggaaatgcagaaccggacatttcaggactgttactcaggcaagttcctgagccactgg
gaccatatcacccggatcaagaaaccggtcatcgcggctgtcaatggctatgctcttggt
gggggctgtgaacttgccatgatgtgcgatatcatctatgctggtgagaaagcccagttt
ggacagccagaaatcctcctggggaccatcccaggtgcagggggcactcagagactcacc
cgagcagtcggcaaatcactagcaatggagatggtcctcactggtgaccgaatttcagca
caggatgccaagcaagcaggtcttgtaagcaagatttttcccgttgaaacactggttgaa
gaggccatccaatgtgcagaaaagatcgccaacaattccaagatcatagtagccatggcg
aaagaatctgtgaatgcagcctttgaaatgacgttaacagaaggaaataagctggagaag
aagctcttctattccacctttgccactgatgaccggagagaagggatgtctgcctttgtg
gagaaaaggaaggccaacttcaaagaccactga

DBGET integrated database retrieval system