KEGG   Rattus norvegicus (rat): 140670Help
Entry
140670            CDS       T01003                                 

Gene name
Ap2b1
Definition
(RefSeq) adaptor-related protein complex 2, beta 1 subunit
  KO
K11825  
AP-2 complex subunit beta-1
Organism
rno  Rattus norvegicus (rat)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    140670 (Ap2b1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    140670 (Ap2b1)
  Nervous system
   04721 Synaptic vesicle cycle
    140670 (Ap2b1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    140670 (Ap2b1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    140670 (Ap2b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q26
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtacttcacaaccaataagaagggagaaatctttgaattaaaagct
gaactcaacaatgaaaagaaagaaaagaggaaggaggctgtgaagaaagtgattgctgct
atgaccgtggggaaggatgtgagctctctcttcccagatgtggtgaactgtatgcagact
gacaacctggaactaaagaagcttgtgtacctctatctgatgaactatgccaagagtcag
ccagacatggccatcatggctgtcaacagctttgtgaaggattgtgaagaccccaatcct
ttgattcgagccttggcagttagaaccatgggatgcatccgggtggacaagattacagag
tatctctgtgaacccctccgcaagtgcttgaaggatgaagacccctatgttcggaaaaca
gcagcagtatgcgtggcaaaactccatgatatcaatgcccagatggtggaagatcaggga
tttctggattctctgcgggatctcatagcagattcaaacccaatggtggtggctaatgct
gtagcagcattgtctgagatcagtgagtctcacccaaacagcaacttacttgatctgaac
cctcagaatatcaataagctgctcacagccctgaatgagtgcactgagtggggccagatt
ttcatcttggactgcctgtctaattacaaccctaaagatgaccgggaagctcagagcatc
tgtgagcgagtgacgcctcggctctctcatgccaattctgcagtggtgctttcagcagta
aaagttctgatgaagtttctagagttgttacccaaggactctgactactacaatatgctg
ctaaagaagctagcgcctccacttgtcactttgctctctggggagccagaagtgcagtat
gttgccctgaggaacatcaacctaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaggtcttctttgtgaagtacaatgatcctatctatgttaaactagagaagttagac
atcatgattcgtcttgcatcccaagccaacattgctcaggttctggcagaactgaaggaa
tatgccactgaagttgatgtggactttgttcgcaaagctgtgagggccattggacggtgt
gccatcaaagtggagcaatcagcagaacgctgtgtgagcacactgcttgatctaatccag
accaaagtaaattatgtggtccaagaggcaattgttgtcatcagggacatcttccgaaaa
taccccaacaagtatgagagcattatcgccacgctgtgtgagaacttggactccctggat
gaacccgatgcccgagcggctatgatttggattgtaggagagtatgctgaaagaatcgat
aatgccgatgagttactagagagcttcctggaaggttttcatgatgaaagcacccaggtg
cagctcacgttgcttaccgccatagtgaaactgtttctcaagaagccatcagaaacacag
gagctggtccaacaggtcttgagcttggccacacaggattctgataatcctgaccttcga
gatcggggttatatttattggcgccttctttcaactgaccctgtgacagccaaagaagta
gtgttgtctgagaagccattgatctctgaggaaacagacctcattgaacctaccctcctg
gatgagctcatctgccacattggttctttggcctccgtgtaccataaacctccgaatgct
tttgtggaagggagccatggcattcatcgcaaacacttgccaattcaccatgggagcact
gatgcaggtgatagccctgttggcaccaccactgcaaccaacctggaacagcctcaggtc
atcccctctcaaggtgaccttctgggggatcttttaaatcttgacctgggtcccccagtg
aatgtcccgcaagtgtcctccatgcagatgggagcagtggatcttttaggaggaggactg
gatagcctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtaggacag
tccttcatcccgtcatcagtgcctgcaaccttcgctccttcacctactcctgctgtggtc
agcagtggtctgaatgacctgtttgagctttccactgggataggcatggcacctggcgga
tatgtggctcctaaggcagtctggctacctgctgtaaaggctaaaggcttggagatttcg
gggacgtttactcaccgccaagggcacatctatatggaaatgaacttcaccaacaaagct
ctgcagcacatgacggattttgccatccagtttaacaagaatagcttcggtgtcatcccg
agcactcccttggccatacatactccgctgatgccaaaccagagcattgatgtgtctctg
cctctcaacaccttgggcccagtcatgaagatggagcctctgaataacttgcaggtggct
gttaaaaacaatattgatgtcttctacttcagctgcctcatcccactcaatgtgcttttt
gtagaagatggcaaaatggaacgccaggtcttccttgcgacgtggaaggatattcccaat
gaaaatgagctccaatttcagattaaggagtgtcatttaaacgctgacacagtttccagc
aagttgcaaaacaacaatgtttacactatcgccaagaggaatgtggaggggcaggacatg
ctgtaccagtccctgaagctcactaatggcatttggattttggcagagctgcggatccag
ccaggaaaccccaattatacgctgtcgctgaagtgtagagcccctgaagtctctcagtac
atctatcaggtctacgacagcattttgaaaaactaa

DBGET integrated database retrieval system