KEGG   Rattus norvegicus (rat): 140670Help
Entry
140670            CDS       T01003                                 

Gene name
Ap2b1
Definition
adaptor-related protein complex 2, beta 1 subunit
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
rno  Rattus norvegicus (rat)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    140670 (Ap2b1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    140670 (Ap2b1)
  Nervous system
   04721 Synaptic vesicle cycle
    140670 (Ap2b1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    140670 (Ap2b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q26
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtacttcacaaccaataagaagggagaaatctttgaattaaaagct
gaactcaacaatgaaaagaaagaaaagaggaaggaggctgtgaagaaagtgattgctgct
atgaccgtggggaaggatgtgagctctctcttcccagatgtggtgaactgtatgcagact
gacaacctggaactaaagaagcttgtgtacctctatctgatgaactatgccaagagtcag
ccagacatggccatcatggctgtcaacagctttgtgaaggattgtgaagaccccaatcct
ttgattcgagccttggcagttagaaccatgggatgcatccgggtggacaagattacagag
tatctctgtgaacccctccgcaagtgcttgaaggatgaagacccctatgttcggaaaaca
gcagcagtatgcgtggcaaaactccatgatatcaatgcccagatggtggaagatcaggga
tttctggattctctgcgggatctcatagcagattcaaacccaatggtggtggctaatgct
gtagcagcattgtctgagatcagtgagtctcacccaaacagcaacttacttgatctgaac
cctcagaatatcaataagctgctcacagccctgaatgagtgcactgagtggggccagatt
ttcatcttggactgcctgtctaattacaaccctaaagatgaccgggaagctcagagcatc
tgtgagcgagtgacgcctcggctctctcatgccaattctgcagtggtgctttcagcagta
aaagttctgatgaagtttctagagttgttacccaaggactctgactactacaatatgctg
ctaaagaagctagcgcctccacttgtcactttgctctctggggagccagaagtgcagtat
gttgccctgaggaacatcaacctaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaggtcttctttgtgaagtacaatgatcctatctatgttaaactagagaagttagac
atcatgattcgtcttgcatcccaagccaacattgctcaggttctggcagaactgaaggaa
tatgccactgaagttgatgtggactttgttcgcaaagctgtgagggccattggacggtgt
gccatcaaagtggagcaatcagcagaacgctgtgtgagcacactgcttgatctaatccag
accaaagtaaattatgtggtccaagaggcaattgttgtcatcagggacatcttccgaaaa
taccccaacaagtatgagagcattatcgccacgctgtgtgagaacttggactccctggat
gaacccgatgcccgagcggctatgatttggattgtaggagagtatgctgaaagaatcgat
aatgccgatgagttactagagagcttcctggaaggttttcatgatgaaagcacccaggtg
cagctcacgttgcttaccgccatagtgaaactgtttctcaagaagccatcagaaacacag
gagctggtccaacaggtcttgagcttggccacacaggattctgataatcctgaccttcga
gatcggggttatatttattggcgccttctttcaactgaccctgtgacagccaaagaagta
gtgttgtctgagaagccattgatctctgaggaaacagacctcattgaacctaccctcctg
gatgagctcatctgccacattggttctttggcctccgtgtaccataaacctccgaatgct
tttgtggaagggagccatggcattcatcgcaaacacttgccaattcaccatgggagcact
gatgcaggtgatagccctgttggcaccaccactgcaaccaacctggaacagcctcaggtc
atcccctctcaaggtgaccttctgggggatcttttaaatcttgacctgggtcccccagtg
aatgtcccgcaagtgtcctccatgcagatgggagcagtggatcttttaggaggaggactg
gatagcctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtaggacag
tccttcatcccgtcatcagtgcctgcaaccttcgctccttcacctactcctgctgtggtc
agcagtggtctgaatgacctgtttgagctttccactgggataggcatggcacctggcgga
tatgtggctcctaaggcagtctggctacctgctgtaaaggctaaaggcttggagatttcg
gggacgtttactcaccgccaagggcacatctatatggaaatgaacttcaccaacaaagct
ctgcagcacatgacggattttgccatccagtttaacaagaatagcttcggtgtcatcccg
agcactcccttggccatacatactccgctgatgccaaaccagagcattgatgtgtctctg
cctctcaacaccttgggcccagtcatgaagatggagcctctgaataacttgcaggtggct
gttaaaaacaatattgatgtcttctacttcagctgcctcatcccactcaatgtgcttttt
gtagaagatggcaaaatggaacgccaggtcttccttgcgacgtggaaggatattcccaat
gaaaatgagctccaatttcagattaaggagtgtcatttaaacgctgacacagtttccagc
aagttgcaaaacaacaatgtttacactatcgccaagaggaatgtggaggggcaggacatg
ctgtaccagtccctgaagctcactaatggcatttggattttggcagagctgcggatccag
ccaggaaaccccaattatacgctgtcgctgaagtgtagagcccctgaagtctctcagtac
atctatcaggtctacgacagcattttgaaaaactaa

DBGET integrated database retrieval system