KEGG   Rattus norvegicus (rat): 140729Help
Entry
140729            CDS       T01003                                 

Gene name
Cacng8
Definition
calcium channel, voltage-dependent, gamma subunit 8
Orthology
K04873  
voltage-dependent calcium channel gamma-8
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    140729 (Cacng8)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    140729 (Cacng8)
  Circulatory system
   04260 Cardiac muscle contraction
    140729 (Cacng8)
   04261 Adrenergic signaling in cardiomyocytes
    140729 (Cacng8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    140729 (Cacng8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    140729 (Cacng8)
   05414 Dilated cardiomyopathy (DCM)
    140729 (Cacng8)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   140729 (Cacng8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q12
AA seq 421 aa AA seqDB search
MESLKRWNEERGLWCEKGVQVLLTTIGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAG
DDGPPHRGGSGSSEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEYL
LRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYI
SANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRSD
LLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRGSSEASPSRDASPGGPGGPGFA
STDISMYTLSRDPSKGSVAAGLASAGGGGGGAGVGAYGGAAGAAGGGGTGSERDRGSSAG
FLTLHNAFPKEAASGVTVTVTGPPAAPAPAPPAPAAPAPGTLSKEAAASNTNTLNRKTTP
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ctggaatcattgaaacgctggaatgaagagaggggtttgtggtgcgaaaagggcgttcag
gtactactgaccaccataggcgcctttgcagcttttggcctcatgaccatcgccatcagc
actgactactggctctacacaagagctctcatctgcaacaccaccaacctcacagcaggt
gatgatggaccaccccatcgtgggggcagtggctcctcagagaagaaggaccctgggggc
ctcacacattcaggcctctggcggatatgctgcctggaagggttgaaaagaggtgtctgc
gtgaagatcaaccacttcccggaggacacggactacgaccacgacagcgcggagtacctg
ctccgagtagtccgggcctccagcatctttcctatcctgagcgccatcctgctgctgctc
gggggcgtgtgcgtagctgcctctcgcgtctacaaatccaaaaggaacatcatcctgggc
gcagggatcctgttcgtggcagcaggcctgagcaacatcatcggggtgatcgtgtacata
tcggcaaacgcgggcgagccaggccccaagagggacgaggagaagaaaaaccactattcg
tatggctggtccttctacttcggcgggctgtcattcatcctggccgaggtgatcggcgtg
ctagccgtcaacatctacatcgagcgcagccgcgaggcacactgccaatcacgctcggac
ctactcaaggccggcggcggcgcgggcggcagtggcgggagcggcccctcggccatcctc
cgtctgcccagttaccgcttccgctaccgccgccgctcccgctccagctcccgaggctcc
agcgaggcctcgccatcgcgggatgcgtctcccggcggccccgggggcccgggcttcgcc
tccacggacatctccatgtacacgctcagtcgcgacccgtccaagggcagcgtggctgcg
gggctggcgagcgccgggggtggaggcggcggtgccggcgtgggtgcctacggcggggcg
gccggggcagcggggggcggcgggacgggctcggagcgggaccgagggagctcagcgggc
ttcctcacgctgcacaacgccttccccaaggaggcggcgtccggcgtcacggtcacggtc
accggaccgcccgctgcgccggcgcccgcgccgcccgctcctgcagcgcccgcgcccggg
acgctgtccaaagaggccgccgcgtccaacaccaacacgctcaacaggaaaaccacgccc
gtgtag

DBGET integrated database retrieval system