KEGG   Rattus norvegicus (rat): 154516Help
Entry
154516            CDS       T01003                                 

Gene name
Ugt1a7c, UDPGT_1-7, Ugt1, Ugt1a7, Ugt1a8
Definition
UDP glucuronosyltransferase 1 family, polypeptide A7C (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    154516 (Ugt1a7c)
   00053 Ascorbate and aldarate metabolism
    154516 (Ugt1a7c)
   00500 Starch and sucrose metabolism
    154516 (Ugt1a7c)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    154516 (Ugt1a7c)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    154516 (Ugt1a7c)
   00860 Porphyrin and chlorophyll metabolism
    154516 (Ugt1a7c)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    154516 (Ugt1a7c)
   00982 Drug metabolism - cytochrome P450
    154516 (Ugt1a7c)
   00983 Drug metabolism - other enzymes
    154516 (Ugt1a7c)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    154516 (Ugt1a7c)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     154516 (Ugt1a7c)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   154516 (Ugt1a7c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q35
AA seq 531 aa AA seqDB search
MAPADIPASLPLGLCLLLASGFGHAGKLLVVPMDGSHWFTMQMVVEKLLPKGHEVVVVVP
EVSWQLGKPLNFTVKTYSVSHTQEDLNREFKFFIDSQWKTQQEGGVLPLLTSPAQGFFEL
LFSHCRSLFKDKKLVEYLKQSSFDAVFLDPFDVCGLTVAKYFSLPSVVFSRGIFCHYLEE
GSQCPSPPSYVPRGILKLTDTMTFKERVWNLLSYMGEHAFCPSFFKTATDIASEVLQTPV
TMTDLFSPVSVWLLRTDFTLELPRPVMPNVIHIGGINCHQRKPLSKEFEAYVNASGEHGI
VVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLG
HPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADD
LENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLT
WYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgcagacattccagcctctcttcctctcggtctgtgcctgctgctggcctct
ggctttgggcatgcaggcaagctgctggtggtgcccatggatggcagccactggttcacc
atgcagatggttgtggagaagctccttcccaaaggccatgaggtggtggtggttgttcca
gaggtcagttggcagctgggaaaaccactgaattttacggtgaaaacgtattcagtttct
cacactcaggaggatttaaatcgggagttcaagttttttattgactctcagtggaaaact
caacaagagggcggagttcttcctctactgactagccctgcccagggtttcttcgaatta
ctgttttcacactgtaggagtttgtttaaggacaagaagttagtggagtacttgaagcag
agttcgtttgatgctgtgtttctggatccttttgatgtgtgtggcttaactgttgccaag
tacttttctctcccgtcagtggtcttcagcagggggatattttgtcactatcttgaagaa
ggctcccagtgccccagtcctccttcatatgtccccagaggtatcttgaaactcacagat
accatgactttcaaggaaagagtgtggaaccttctttcctacatgggggagcatgcattc
tgtcccagttttttcaaaactgctaccgacattgcctctgaagttctccagaccccggtg
actatgacagacctcttcagcccagtgtccgtttggttgttacgcacagacttcacgttg
gaattacccagacctgtgatgcccaatgtgatccacattggagggatcaactgccaccaa
aggaagccactttccaaggaatttgaagcctatgtcaacgcctccggagaacatggcatc
gtggttttctctttgggatccatggtctcagagattccagagaagaaagcgatggaaatt
gctgaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagacca
tcgaaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctgcttggt
catccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaaggaata
tgcaatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaacgccaag
cgcatggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgccgatgat
ttggaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatcatgcgc
ctctccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttctgggtg
gagtacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgacctcacc
tggtaccagtaccactccttggacgtgattggctttctcctggccatcgtgttgacggtg
gtcttcattgtctataaaagttgtgcctatggctgccggaaatgctttgggggaaagggt
cgagtgaagaaatcacacaaatccaagacccactga

DBGET integrated database retrieval system