KEGG   Rattus norvegicus (rat): 154968Help
Entry
154968            CDS       T01003                                 

Gene name
Mgea5, Ncoat, O-GLCNACASE
Definition
meningioma expressed antigen 5 (hyaluronidase) (EC:3.2.1.52 2.3.1.48)
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     154968 (Mgea5)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     154968 (Mgea5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q54
AA seq 916 aa AA seqDB search
MVQKESQAALEERESERNANPASVSGASLEPSAAPAPGEDNPSGAGAAAGTGAAGGARRF
LCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLM
TLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM
CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPSVSQSPYLRTVGEK
LLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRS
TELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLE
NEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKTSVVDGTPLVAA
PSLNATTVVTTVYQEPIMSQGAALSGEPSALTKEEEKKQPDEEPMDMVVEKQEESEHKSD
NQILTEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCINDIAPMQTDEQANKEQFVP
GPNEKPLYAAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD
SEKIEEWRSRAAKFEEMCALVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQW
LGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPY
FPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYA
LGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFP
SLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIA
KMEGFPKDVVILGRSL
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaaggagagtcaagcggcgctggaggagcgggagagtgagcgcaacgccaat
cctgcctccgtctcgggggcttcgttggagccgtctgcagctccggcccccggagaagac
aacccctcgggagctggggcggcggccgggaccggggcggccggcggggcccgcaggttc
ctgtgcggtgtagtggaagggttttatggaagaccttgggttatggagcagagaaaagag
ctctttagaaggcttcagaaatgggaattaaatacatacttgtatgctccgaaggatgac
tacaaacataggatgttttggcgagagatgtattcagtggaagaagctgagcaacttatg
actctcatctctgctgcacgagaatatgagatagaattcatctatgctatttctccagga
ttagatatcactttttctaacccaaaggaagtatcaacattgaaacgcaaattggaccag
gtctcccagtttgggtgcaggtcatttgctttgctttttgacgatattgatcataacatg
tgtgcagcagacaaagaagtgttcagttcttttgcacatgcacaagtttccatcacaaat
gaaatctatcagtacctgggagagccggaaaccttcctcttctgtcccacagaatactgc
ggcactttctgttatccaagtgtatctcagtctccttacttgaggactgtgggtgaaaag
ctgctacctggaattgaggtgctttggacaggtccaaaagttgtttcaaaagaaattcca
gtagaatctattgaagaagtttctaagatcattaagagagccccagtgatctgggataac
attcatgctaatgactatgatcagaagaggctgtttctgggtccctacaaaggaagatcc
acagagctcatcccacggttgaagggagtgctgactaatccaaattgtgaatttgaagcc
aactatgttgccatccacacccttgccacttggtacaagtcaaacatgaacggagtgagg
aaggacgtggtgatgactgacagtgaagacagtactgtctcaatacagataaagttagaa
aatgaaggcagtgatgaagacattgagactgatgtgctctacagtccacagatggcttta
aagctggccttaactgagtggctgcaggagttcggtgtaccgcatcagtacagcagtaga
caggttgcacacagtggagctaagacaagcgtagtggacgggactcccttggttgcagca
ccttctttaaatgccacaactgtagttacaacagtttaccaggagcccattatgagccag
ggagcagctttgagtggtgagccctcagctctgaccaaggaagaagaaaagaaacagcca
gatgaggaacccatggatatggtggtagagaagcaagaagagtcagagcacaagagtgac
aaccagatactaactgagatcgtcgaagctaaaatggcagaggagttgaaaccaatggac
actgataaggaaagcatagccgagtcaaaatccccagagatgtctatgcaggaagactgc
attaacgacatcgctcctatgcagacagacgagcaagcaaacaaagagcagtttgtgcca
ggtccaaatgaaaaacctttgtacgctgcagaaccagtgactctggaggatttacagtta
cttgctgatctcttctaccttccttatgagcatggacccaaaggagcacagatgctacgg
gagttccagtggcttcgagcaaacagtagtgttgtcagtgtcaattgcaaagggaaagac
tctgaaaaaattgaagaatggcggtcacgagcagccaagtttgaagaaatgtgcgcacta
gtgatggggatgttcacccggctctccaactgtgccaacaggacaatcctttatgacatg
tactcctatgtgtgggatatcaagagtataatgtctatggtgaagtcttttgtgcagtgg
ttagggtgtcgtagtcattcttcagcacagttcttaattggagaccaagaaccctgggcc
tttagaggtggtctagcaggagagttccagcgtttgctgccaattgatggagcaaatgat
ctctttttccaaccacccccactgactcctacctccaaggtttatactatcagaccttat
ttccctaaagatgaggcttccgtgtacaagatttgcagagaaatgtatgatgatggagtg
ggtttaccttttcaaagtcagcctgaccttattggagacaagttagtaggaggactgctt
tccctcagcctggattactgttttgtcctcgaagatgaagatggtatttgtggttatgcc
ttaggcactgtagatgtgacccccttcattaaaaagtgcaaaatttcctggattcccttc
atgcaggagaagtatactaagccaaatggagacaaagagctctcagaagctgagaaaata
atgttgagtttccatgaagagcaggaggtattaccagaaactttccttgccaacttccct
tctctgataaaaatggatattcataaaaaggtcactgacccaagtgttgccaaaagcatg
atggcttgcctcctgtcttcactaaaggccaatggctcccggggggctttctgtgaagta
agaccagatgataaaaggattctggaattttacagcaagttaggctgttttgaaattgca
aaaatggaaggatttccaaaggatgtggttatacttggtcgaagcctgtga

DBGET integrated database retrieval system