KEGG   Rattus norvegicus (rat): 170670Help
Entry
170670            CDS       T01003                                 

Gene name
Hadha, RGD1560655
Definition
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit (EC:4.2.1.17 1.1.1.211)
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
rno  Rattus norvegicus (rat)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    170670 (Hadha)
   01212 Fatty acid metabolism
    170670 (Hadha)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    170670 (Hadha)
   00650 Butanoate metabolism
    170670 (Hadha)
  Lipid metabolism
   00062 Fatty acid elongation
    170670 (Hadha)
   00071 Fatty acid degradation
    170670 (Hadha)
   01040 Biosynthesis of unsaturated fatty acids
    170670 (Hadha)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    170670 (Hadha)
   00310 Lysine degradation
    170670 (Hadha)
   00380 Tryptophan metabolism
    170670 (Hadha)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    170670 (Hadha)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     170670 (Hadha)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     170670 (Hadha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q14
AA seq 763 aa AA seqDB search
MVASRAIGSLSRFSAFRILRSRGCICHSFTTSSALLSRTHINYGVKGDVAVIRINSPNSK
VNTLNKEVQSEFVEVMNEIWANDQIRSAVLISSKPGCFVAGADINMLASCTTPQEAARIS
QEGQKMFEKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLGVPEVLLGILP
GAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLVDPLGPGIKSPEERTIEYL
EEVAVNFAKGLADRKVSAKQSKGLMEKLTSYAMTIPFVRQQVYKTVEEKVKKQTKGLYPA
PLKIIDAVKTGLEQGNDAGYLAESEKFGELALTKESKALMGLYNGQVLCKKNKFGAPQKT
VQQLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSF
ERDSIFSNLIGQLDYKGFEKADMVIEAVFEDLAVKHKVLKEVESVTPEHCIFASNTSALP
INQIAAVSQRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLKQGKVIIVVK
DGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDALTTGFGFPVGAATLADEVGIDVAQHVA
EDLGKAFGERFGGGSVELLKLMVSKGFLGRKSGKGFYIYQSGSKNKNLNSEIDNILVNLR
LPAKPEVSSDEDIQYRVITRFVNEAVLCLQEGILATPEEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQKVVDRLRKYESAYGTQFTPCQLLRDLANNSSKKFYQ
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgtcccgggcaattggcagtctcagtcgcttctctgccttcaggatcctgcgc
tccagaggctgcatttgccacagctttacaacttcttctgctttgctgtctagaacccat
attaattatggagtcaaaggggatgtggcagttattcggattaactcgcccaattcaaag
gtaaatacattgaataaagaagtacaatcagagttcgtagaagtaatgaacgaaatctgg
gccaacgaccaaatcaggagcgccgtccttatttcgtcaaagcctggctgctttgttgca
ggtgctgacatcaacatgctggcctcttgtacaacgccccaagaagcagcacgaatatca
caagaaggacagaaaatgtttgagaaacttgaaaagtcaccaaagcctgttgttgccgcc
atcagtggatcctgcttgggaggcggacttgagcttgccatagcatgtcaatacagaata
gcaacaaaagacagaaaaacagtattaggtgtccctgaagtgttgctgggaatcttacca
ggagccggaggtacccagaggctgcccaaaatggtgggtgtgcctgctgcttttgacatg
atgctgactggtaggaacattcgtgcagacagagcaaagaaaatgggactggttgaccag
ttggtggacccgctaggaccaggaataaaatctccagaggaaaggacaattgaataccta
gaagaagttgcagttaattttgccaaaggcctggctgacaggaaggtctctgcaaagcag
agcaaaggcctgatggaaaagctgacatcgtatgccatgactatcccatttgtcagacaa
caggtttacaaaacagtggaagaaaaagtgaagaagcagaccaaaggcctttaccctgca
cctttgaagataattgacgctgtgaagactggacttgagcaaggaaatgatgctggctat
cttgccgaatcagagaaatttggagagcttgcattgaccaaagaatcaaaagccctgatg
gggctttataatggccaggtcctgtgcaagaaaaataaatttggagcgccacagaagact
gttcagcagctagccatccttggcgcagggctgatgggggctggcattgcccaggtctct
gtggacaagggactgaaaactcttcttaaagacactacagtgacagggctgggccgggga
cagcaacaagtgttcaaaggactgaatgacaaggtaaagaagaaggcactcacatccttc
gaaagggactccatcttcagcaacctgatcgggcagctcgactacaagggcttcgagaag
gctgacatggtgattgaggctgtcttcgaggacctcgctgttaagcacaaagtgttaaag
gaagtggaaagcgtgactccagaacactgtatcttcgccagcaacacatctgctctccca
atcaatcaaattgctgctgtgagccaaaggcctgagaaggtgatcggcatgcactacttc
tctcctgtggacaagatgcagcttctagagatcatcacaactgacaaaacctccaaggac
accacagcgtctgccgtggccgtgggtctcaagcaggggaaggtcatcattgtggtcaag
gacggacctggcttctacaccaccaggtgtcttgctcccatgatgtcagaagtcataaga
atcctccaggaaggagttgaccctaagaagctggacgccttgaccacaggcttcggcttc
cctgtgggtgctgccaccctggcagatgaagtagggatagatgtagcacagcacgtagca
gaagatctaggcaaagccttcggggagcggtttggaggtggcagcgtagaactgctgaaa
ctgatggtctccaagggcttcttgggtcgcaagtctgggaagggcttctacatctatcag
tcgggctcaaagaataagaatttgaattctgaaatagataatatcttggtaaacctgagg
ctgcctgccaagcccgaggtctcctctgatgaagacatccagtaccgtgtgataacaagg
tttgtgaatgaggcagtcctgtgcctacaggaagggatcctagccacgcctgaagaggga
gacatcggagcagtctttgggcttggctttcccccttgtctcggagggcccttccgcttt
gtggatctgtatggtgctcagaaggtagtggaccggctccggaagtatgagtctgcctat
gggacacagtttaccccgtgtcagctactccgcgaccttgctaacaactctagcaagaag
ttctaccagtga

DBGET integrated database retrieval system