KEGG   Rattus norvegicus (rat): 170897Help
Entry
170897            CDS       T01003                                 

Gene name
Sphk1
Definition
sphingosine kinase 1 (EC:2.7.1.91)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
rno  Rattus norvegicus (rat)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rno00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:rno04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:rno04020]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:rno04666]
Human Diseases; Infectious diseases; Tuberculosis [PATH:rno05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q32.3
AA seq 383 aa AA seqDB search
MQPADCPRGLLPRPCRVLVLLNPRGGKGKALKLFQSRVRPLLEEAEVSFKLMLTERQNHA
RELVCAEELGHWDALAVMSGDGLMHEVVNGLMERPDWESAIQKPLCSLPGGSGNALAASL
NYYAGHEQVTNEDLLINCTLLLCCRQLSPMNLLSLHTASGRQLYSVLSLSWGFVADVDLE
SEKYRSLGEIRFTVGTFFRLASLRIYQGQLAYLPVGKAASKIPASSLAQKGPANTYLVPL
EEPVPPHWTVVPEQDFVLVLVLLHTHLSTEMFAAPMGRCEAGVMHLFYIRAGVSRAMLLR
LFLAMQKGKHMDLDCPYLVHVPVVAFRLEPRNQRGVFSVDGELMVCEAVQGQVHPNYLWM
VSGSSDSPSGRDSQRRPPPEEPI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccagcagactgtccccggggactgctcccacggccatgcagagtgttggtgctg
ctgaacccccggggtggcaagggcaaggctctgaagctctttcagagccgtgtgcggccc
cttctggaggaggctgaggtatcctttaaactgatgctcaccgaacggcagaaccatgcc
agggagctggtgtgtgcagaagaactgggtcactgggatgccttggcggtcatgtccggt
gacggtctgatgcacgaggtggtgaatgggctaatggaacgacctgactgggagagtgcc
atccagaaacccctatgtagcctccctggaggctctggcaatgcgctggcagcttctttg
aactactatgctgggcacgagcaggtcactaatgaagatctcctgatcaactgcacactg
ctgttatgctgccggcagctgtcacccatgaatctgctgtccctgcacaccgcttccgga
cggcaactctattctgttctcagtctgtcctggggtttcgttgctgacgtggacttggag
agtgagaaatacaggagcttgggggagattcgtttcacggtgggaaccttttttcgccta
gcaagcctgcgcatttaccaaggccaactggcctaccttcctgtagggaaggctgcctct
aagatacctgcttcctcactggcacagaagggccctgccaacacatacctcgttcctctg
gaggagccagtgccacctcattggactgtggtgccagagcaggacttcgttctggtgctg
gtgctgcttcacacccacctgagcacagagatgtttgcagcacccatgggccgctgcgag
gctggtgttatgcatctgttctatatacgtgcgggggtgtcaagggccatgctgctgcgc
ctcttcctggccatgcagaagggcaagcatatggacctcgactgcccgtacttggttcat
gtgccagtggttgccttccgcctggaacccaggaaccagaggggagtgttttctgtggac
ggggagctgatggtgtgtgaagctgtgcagggccaagtgcacccaaactacctttggatg
gtctctggtagcagtgactccccgtccggccgggactcccagcggaggccacctccagaa
gaaccaatatga

DBGET integrated database retrieval system