KEGG   Rattus norvegicus (rat): 170897Help
Entry
170897            CDS       T01003                                 

Gene name
Sphk1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05152  Tuberculosis
Module
rno_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    170897 (Sphk1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    170897 (Sphk1)
   04371 Apelin signaling pathway
    170897 (Sphk1)
   04020 Calcium signaling pathway
    170897 (Sphk1)
   04072 Phospholipase D signaling pathway
    170897 (Sphk1)
   04071 Sphingolipid signaling pathway
    170897 (Sphk1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    170897 (Sphk1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    170897 (Sphk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     170897 (Sphk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 170897
NCBI-ProteinID: NP_001257736
RGD: 620048
Ensembl: ENSRNOG00000010626
UniProt: Q91V26 A0A0G2JWE5
Position
10q32.1-q32.2
AA seq 383 aa AA seqDB search
MQPADCPRGLLPRPCRVLVLLNPRGGKGKALKLFQSRVRPLLEEAEVSFKLMLTERQNHA
RELVCAEELGHWDALAVMSGDGLMHEVVNGLMERPDWESAIQKPLCSLPGGSGNALAASL
NYYAGHEQVTNEDLLINCTLLLCCRQLSPMNLLSLHTASGRQLYSVLSLSWGFVADVDLE
SEKYRSLGEIRFTVGTFFRLASLRIYQGQLAYLPVGKAASKIPASSLAQKGPANTYLVPL
EEPVPPHWTVVPEQDFVLVLVLLHTHLSTEMFAAPMGRCEAGVMHLFYIRAGVSRAMLLR
LFLAMQKGKHMDLDCPYLVHVPVVAFRLEPRNQRGVFSVDGELMVCEAVQGQVHPNYLWM
VSGSSDSPSGRDSQRRPPPEEPI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccagcagactgtccccggggactgctcccacggccatgcagagtgttggtgctg
ctgaacccccggggtggcaagggcaaggctctgaagctctttcagagccgtgtgcggccc
cttctggaggaggctgaggtatcctttaaactgatgctcaccgaacggcagaaccatgcc
agggagctggtgtgtgcagaagaactgggtcactgggatgccttggcggtcatgtccggt
gacggtctgatgcacgaggtggtgaatgggctaatggaacgacctgactgggagagtgcc
atccagaaacccctatgtagcctccctggaggctctggcaatgcgctggcagcttctttg
aactactatgctgggcacgagcaggtcactaatgaagatctcctgatcaactgcacactg
ctgttatgctgccggcagctgtcacccatgaatctgctgtccctgcacaccgcttccgga
cggcaactctattctgttctcagtctgtcctggggtttcgttgctgacgtggacttggag
agtgagaaatacaggagcttgggggagattcgtttcacggtgggaaccttttttcgccta
gcaagcctgcgcatttaccaaggccaactggcctaccttcctgtagggaaggctgcctct
aagatacctgcttcctcactggcacagaagggccctgccaacacatacctcgttcctctg
gaggagccagtgccacctcattggactgtggtgccagagcaggacttcgttctggtgctg
gtgctgcttcacacccacctgagcacagagatgtttgcagcacccatgggccgctgcgag
gctggtgttatgcatctgttctatatacgtgcgggggtgtcaagggccatgctgctgcgc
ctcttcctggccatgcagaagggcaagcatatggacctcgactgcccgtacttggttcat
gtgccagtggttgccttccgcctggaacccaggaaccagaggggagtgttttctgtggac
ggggagctgatggtgtgtgaagctgtgcagggccaagtgcacccaaactacctttggatg
gtctctggtagcagtgactccccgtccggccgggactcccagcggaggccacctccagaa
gaaccaatatga

DBGET integrated database retrieval system