KEGG   Rattus norvegicus (rat): 170915Help
Entry
170915            CDS       T01003                                 

Gene name
Ep300
Definition
E1A binding protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    170915 (Ep300)
   04330 Notch signaling pathway
    170915 (Ep300)
   04350 TGF-beta signaling pathway
    170915 (Ep300)
   04630 Jak-STAT signaling pathway
    170915 (Ep300)
   04066 HIF-1 signaling pathway
    170915 (Ep300)
   04068 FoxO signaling pathway
    170915 (Ep300)
   04024 cAMP signaling pathway
    170915 (Ep300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    170915 (Ep300)
  Cell communication
   04520 Adherens junction
    170915 (Ep300)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    170915 (Ep300)
   04916 Melanogenesis
    170915 (Ep300)
  Nervous system
   04720 Long-term potentiation
    170915 (Ep300)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    170915 (Ep300)
   05206 MicroRNAs in cancer
    170915 (Ep300)
   05203 Viral carcinogenesis
    170915 (Ep300)
   05211 Renal cell carcinoma
    170915 (Ep300)
   05215 Prostate cancer
    170915 (Ep300)
  Neurodegenerative diseases
   05016 Huntington's disease
    170915 (Ep300)
  Infectious diseases
   05152 Tuberculosis
    170915 (Ep300)
   05166 HTLV-I infection
    170915 (Ep300)
   05164 Influenza A
    170915 (Ep300)
   05161 Hepatitis B
    170915 (Ep300)
   05168 Herpes simplex infection
    170915 (Ep300)
   05169 Epstein-Barr virus infection
    170915 (Ep300)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     170915 (Ep300)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    170915 (Ep300)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    170915 (Ep300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
7q34
AA seq 2413 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQNSPGLSLINS
MVKSPMAQTGLTSPNMGMGSSGPNQGPTQSTAGMMNSPVNQPAMGMNTGMNAGMNPGMLA
AGNGQGIMPNQVMNGSIGAGRGRPNMQYPNAGMGNAGSLLTEPLQQGSPQMGGQPGLRGP
QSHKMGMMSNPTPYGSPYTQNSGQQIGASGLGLQIQTKTVLPNNLSPFAMDKKAVTGGGM
PNMGQQPTPSVQQPGLVNPVAPGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
IPPQPPVQAKNQQSQPSGQSPQGMRSMNNMSASPMGVNGGVGVQTPNLLSDSMLHSTINS
QNPMMNENASVASLGPLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAPGMVPVPMNTAPNMGQQPTGMTTNGPLPDPSMIRGSVPNQMMPRMTPQPGLNQFGQMN
IPQPPIGPRQPSPLQHHGQLAQSGSLNPPMGYGPRMQQTSGQNQFLSQTQFPSQGMNVTN
MPLAPSSSQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPTLPQQAHQNSPSPVPSRTP
TPHHTPPSIGTQQPAATAIPAPVPTPPAMPPGAQPQSLRPPSRQTPTPPTHLPPQVQPSL
PVPPADQSQPQPRSQQSTAASVPTPTAPLLPPQPPTPLSQPAVSVEGQVSNPPSTSSTEV
NSQTIPEKQPSQEVKMEVKMDVDQPEPADAQPDDTKEAKAEDGKVEPTETEERGPELKTE
VKEEEDQPSTSAAQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQ
LLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKYC
SKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCE
KCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHH
EVIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVT
VRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYG
SDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSE
GDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKELP
YFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSS
LSRGNKKKPGVPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPCD
LMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWH
CTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSL
VHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCP
VPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATPTTPTGQQ
PATPQTPQPQPTSQPQPTPPNNMTPYLPRTQTAGPVSQGKAAGQVTPPTPPQTAQPPLPG
PPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMAPMAPMGMNPPPMARGPGGHLDPG
MGPAGMQQQPPWAQGGMPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKP
GTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPLPGQ
PGMPQGQPGLQPPTMPGQQGVHSNPALQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSP
QAQQMNMNHNTMPSQFRDILRRQMMQQQGAGPGIGPGMANHNQFQQPQGIGYPPQQQQQQ
QQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQ
HMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSP
QTSSPHPGLVAAQAANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSADSAD
LSSNLSQSTLDIH
NT seq 7242 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggaacccgggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggttcactgtttgacctggaa
catgacttaccagatgaattaatcaactcaacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctccaaacataaacaa
ctgtcagaattgctaaggtctggtagttcccccaacctcaatatgggagttggtggccca
ggccaagttatggccagccaggcccaacagaatagccctggattaagtttgataaatagc
atggtcaaaagcccaatggcacagacaggcttgacttctcccaatatggggatgggcagt
agtggaccaaatcagggtcctactcagtccacagcaggtatgatgaacagcccagtgaat
caacctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttggct
gcaggcaatggacaagggataatgcccaatcaagtcatgaatggttcaattggagcaggc
cggggaaggccaaacatgcagtacccaaatgcaggcatgggcaatgctggcagtttattg
actgagccactacagcagggctctcctcagatgggaggacaaccaggattgagaggcccc
cagtcacataagatgggaatgatgagcaatcccactccttatggttcaccatacactcag
aattctggacagcagattggagcaagtggccttggtctccaaattcagacaaagactgtt
ttaccaaataacctttctccatttgcaatggacaaaaaagcagttactggtgggggaatg
cccaacatgggccaacagcctaccccgtcggtccaacagccaggcctggtgaatccggtt
gccccagggatgggttctggagcgcatacagctgatccagagaagcgcaaactcatccag
cagcagcttgttctccttttacatgctcacaagtgccagcgccgggagcaagctaatgga
gaagtgaggcagtgcaatcttccccactgtcgcaccatgaaaaatgttctaaaccatatg
acacattgtcagtcaggcaaatcctgtcaagtggcacattgtgcgtcttctcgacaaatc
atttcacactggaaaaattgcacaaggcatgattgtcctgtgtgtcttcctctcaaaaat
gctggggataagcgaaatcaacagtcaattttgactggagcaccagtcgggcttggaaac
cctagctctctaggagtgggacagcagtccacccctagcctaagcactgtcagtcagatt
gatcccagctctatagagcgagcttatgctgctctcggactaccctatcaagtaaaccag
attccaccacaaccccccgtccaagctaagaatcaacaaagtcagccgtctggacagtct
ccccaaggcatgcggtccatgaacaacatgagtgccagtcctatgggtgtaaatggaggt
gtaggggttcagacaccgaatcttctttctgactccatgttgcattcaaccataaattct
cagaacccaatgatgaatgaaaatgccagtgtggcctctctgggtcctttgcccacagca
gcccagccatctagtactggaattcgaaaacagtggcatgaagatattactcaggatctt
cgaaaccaccttgttcataaacttgttcaagccatatttcccactcccgatcctgctgct
ttaaaagaccgacggatggaaaaccttgttgcatatgctcgtaaagtagaaggggacatg
tatgaatctgcaaacaatagagcggaatattaccacctcttagctgagaagatctataag
atccagaaagaactagaagagaaacgaaggactagactacagaaacaaaacatgctacca
agtgctcctggcatggttccagtgcctatgaatactgcacctaacatgggacagcaacca
acaggaatgactaccaatggtcctctacctgatccatctatgatccgtggcagtgtgcca
aaccagatgatgcctcggatgacaccacaacctggtttgaaccagtttggacagatgaat
ataccacagccccctattgggccccggcagccgtctcctctccagcatcacggacagctg
gcccagtcgggctcactcaatccgcctatgggctatggacctcgcatgcagcagacttct
ggccagaaccaatttctctcccagactcagtttccatcccaaggaatgaatgtaacaaac
atgcctttggctccatccagcagtcaagcaccagtgtctcaagcacagatgtccagttct
tcctgcccagtgaactctcctataatgcctccagggtctcaagggagccatattcactgt
cctactctgcctcaacaagctcatcagaattcaccttctcctgttcctagccgtacccct
actcctcatcacacacccccaagcatagggactcaacaaccagcagcaacagcaattcca
gcgcctgttcctacaccccctgccatgccgcctggagcacagccccagtctctacgcccc
ccatctagacagactcctacaccaccaacacatctgcctccccaagtgcaaccttcactt
cctgttcctcctgctgaccagtcccagccacagcctcgctcacagcagagcacagcagct
tctgtccccaccccaacagcaccactgctgcctcctcagcctcctactccactttctcag
ccagctgtaagtgttgaaggccaggtgtcaaaccctccatctactagtagcacagaagtg
aattctcagactattcctgagaagcaaccatcacaggaagtcaaaatggaggttaaaatg
gacgtggatcaaccagaacctgcagatgctcaacctgatgacacaaaggaggctaaagct
gaggatggtaaagtagaacctacagaaacagaggagagaggccctgagttaaagactgaa
gtgaaagaggaggaggaccagccgagcacctctgctgcacagtcctcccctgctcctgga
cagtcaaagaagaagattttcaaaccagaagaattacggcaggctctgatgccaacattg
gaggcactttaccgacaggacccagaatcccttccctttcgtcagcctgtggacccgcag
cttctaggaatccctgattactttgatattgtgaagagccccatggatctttctacaatc
aagaggaagttagatactggacagtatcaagagccctggcaatatatagatgatatttgg
cttatgttcaacaatgcttggttatataaccgtaaaacttcaagggtatacaaatattgc
tccaaactttctgaagtatttgaacaagaaattgaccctgtcatgcaaagccttggctac
tgctgtggcagaaagttggagttctctccacagactctgtgttgctatggcaaacagtta
tgcacaatcccccgtgatgctacttactacagttaccagaacaggtatcatttctgtgag
aagtgtttcaatgaaatccaaggggagagcgtttctttgggtgatgacccttcccaacct
caaactacaataaataaagaacaattttccaagagaaaaaatgacacactggatccagaa
ctgtttgttgagtgcacagagtgtggaagaaagatgcaccaaatctgtgtccttcaccat
gaggtcatctggccatctgggtttgtctgtgatggctgtttaaagaaaactgcacgaact
aggaaagaaaataagttttctgctaaaagattgccttctaccagacttgggacctttctg
gagaatcgagtgaatgactttctgaggcgacaaaatcaccctgaatcaggagaggtcact
gttcgggttgttcatgcttctgacaaaactgtggaggtgaaaccaggcatgaaagcaagg
tttgtagatagtggagagatggcagaatcttttccatatcgaaccaaggccctgtttgcc
tttgaagaaattgatggtgttgacttgtgtttcttcggcatgcatgttcaagaatatggc
tctgactgtccccctcccaaccagaggagagtatacatatcttacctcgatagtgttcat
ttcttccgtcctaaatgcttgcggactgcagtctatcatgaaattctaattggatatttg
gagtatgtcaagaaattaggatacacaacagggcatatctgggcctgtccaccaagtgaa
ggagatgactatatcttccattgccatccacccgatcagaagataccaaagcccaagcgc
ctgcaagaatggtacaaaaagatgcttgacaaggctgtgtcagaacgcattgtccatgac
tacaaggatattttaaagcaagctactgaagatcgattaacaagtgcaaaggaattacct
tactttgaaggtgacttctggcccaatgttctggaagaaagcatcaaggaacttgaacag
gaagaggaagagaggaaacgggaagaaaacaccagcaacgagagtaccgatgtaacaaaa
ggcgatagcaaaaatgctaagaagaagaataacaagaagaccagcaaaaacaagagcagc
ctgagcaggggcaacaagaagaagcctggcgtgcccaacgtgtctaatgacctttctcag
aaactgtacgccaccatggaaaagcataaagaggtcttctttgtaatccgcctcatcgct
tgtcctgctcccaactccctgcctcccattgttgatcctgaccctctcatcccctgcgac
ctgatggatggtagagatgcattcctcacccttgcaagggataagcacctggaattctct
tcacttcgaagagcccagtggtctaccatgtgcatgctggtggagctgcacacacagagt
caagatcgctttgtctacacctgcaatgagtgcaagcaccacgtggagacacgctggcac
tgcactgtgtgtgaggattatgacctgtgtatcacctgttacaacactaaaaatcatgac
cacaaaatggagaaattaggcctgggcttggatgacgagagcaacaaccagcaagccgca
gccacacagagcccaggagactctcgtcgcctgagcatccaacgctgcatccagtcgctg
gtgcacgcctgccagtgccgcaatgccaactgctccctcccttcctgccagaagatgaag
agggtggtgcagcacaccaaaggctgcaaacggaaaaccaacggtgggtgccccatttgc
aagcagctcattgccctttgctgctaccatgccaagcactgccaggagaacaagtgcccg
gtgccgttctgcctcaacatcaaacagaagctccggcagcagcagctgcagcaccggctc
caacaggctcagatgctgcgcaggaggatggccagcatgcaacggactggggtggcgggg
cagcagcagggcctgccgtccccaactcctgctactccaactaccccaactggccaacag
ccagccaccccacagacaccccagccccaacccacctctcaaccgcagcccactcctccc
aacaacatgacaccctacttacccaggactcaaactgctggccctgtgtcccagggtaag
gcagcaggccaagtaaccccaccaaccccacctcagactgctcagcccccacttccaggg
cctccacccgcagcagtagagatggcaatgcagattcagagggcagcagagacacagcgc
cagatggcccatgtacaaattttccaaaggccaatccagcaccagatggcacctatggcc
cctatgggtatgaacccacctcctatggccagaggtcctggtggacatttggatccagga
atgggtcccgcaggaatgcagcagcagccaccttgggcccaaggaggaatgcctcagccc
cagcagatgcagtcagggatgccaaggccagccatgatgtcagtggcccagcatggtcag
cctttgaacatggctccacagccaggattgggccaagtaggtgtgagccctctcaagcca
ggcactgtgtctcaacaagccttacaaaaccttttgcggactctcaggtctcccagttct
cccttacagcagcaacaggtgcttagtatccttcatgccaacccccaactgttggctgca
ttcatcaagcagcgggctgccaagtatgccaactctaatccacagcctctccctggacag
cctggcatgccccagggacagccagggctgcagccaccgaccatgccaggtcagcaaggt
gtccactccaacccagccttgcagaacatgaatcctatgcaggcaggagtccagagagct
ggcttgcctcagcagcagcctcagcagcagctccagccacccatgggagggatgagtccc
caagctcagcaaatgaacatgaatcacaacaccatgccttcacagttcagagacatctta
agacgtcagatgatgcaacagcagggagcagggccaggaattggccctggaatggccaac
cacaaccagttccagcagccccaaggaattggctatccaccccaacagcagcagcagcag
caacagcagcgaatgcagcatcacatgcagcaaatgcagcaaggaaatatgggacagatg
ggtcagcttccccaggctttgggggctgaggcgggagccagtctacaggcctatcagcag
cgactccttcagcagcagatggggtctcctgctcagcccaaccctatgagcccacagcag
catatgctcccaaatcaggcacagtccccacacctacaaggtcaacaaatccctaattct
ctctccaatcaagtgcgctctccccagcctgtcccttctcctcgaccacagtctcagccc
ccccattccagcccgtctccgaggatgcagcctcagccttctccacaccatgtttctcca
cagaccagttccccacaccctggactggtagctgcccaggctgccaaccccatggaacaa
gggcattttgccagcccagaccagaattcaatgctttcacagctcgctagcaatccaggc
atggcaaacctccacggtgcaagtgccacggacctgggactgagcgccgatagtgcagac
ttgagttcaaacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system