KEGG   Rattus norvegicus (rat): 170926Help
Entry
170926            CDS       T01003                                 

Gene name
Cysltr2, Cyslt2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    170926 (Cysltr2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    170926 (Cysltr2)
G protein-coupled receptors [BR:rno04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    170926 (Cysltr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
15p11
AA seq 309 aa AA seqDB search
MGVTGTPSYYSDKNCTIENFKRDFYPIIYLIIFVWGALGNGFSIYVFLQTYKKSTSVNVF
MLNLAISDFLFISTLPFRADYNFRGSDWIFGDWACRIMSYSLYVNMYTSIYFLTVLSIVR
FLATAHPFQMLHITSVRSAWILCGIIWVFIMASSGLLLKHGQEKKNNTTLCFELNLQKFK
NLVILNYIALGVGFLLPFFILTICYLLIIRVLLKVEIPESGPRDAQRKALTTIVIAMIIF
LLCFLPYHALRTIHLVTWDADSCMDELHKATVITLTLAAANSCFNPFLYYFAGENFKARL
RAIFSKDHL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgggagtaactgggacccccagctattatagtgacaagaactgtacaatagaaaacttc
aagagggacttttaccctatcatctacctgataatatttgtctggggagccttgggaaat
ggcttttccatatatgtcttcctacagacttacaagaagtccacatctgtgaatgttttc
atgctcaacctggccatttcagatttcctattcataagcaccctgcccttcagggctgac
tataatttcagaggttctgattggatatttggggactgggcctgcagaattatgtcttat
tctttatatgtcaacatgtatactagcatttatttcctaactgtgctgagtattgtgcgc
ttcctggccactgcccaccccttccagatgctccatatcaccagcgttaggagtgcctgg
atcctctgtgggattatatgggtcttcatcatggcttcctcaggactgcttctgaagcat
ggccaagagaagaaaaataacactacattgtgctttgagctgaatctccaaaagtttaaa
aatctcgtcatcttgaactacattgcattaggggtgggcttcttgcttccatttttcata
ctcaccatctgctacctgttgatcatccgggtcttgttaaaggtggagattccagaatca
ggtccacgggatgctcagaggaaggcactgaccactatcgtcattgccatgatcatcttc
ctcctctgttttctgccataccatgcacttcggaccatccacttggtcacatgggatgca
gattcatgtatggatgaattacataaggccacggtcatcactctgaccttggctgcagcc
aacagctgcttcaatccctttctctattattttgctggagagaatttcaaagcacgatta
agggctatattcagcaaagatcatctatag

DBGET integrated database retrieval system