KEGG   Rattus norvegicus (rat): 171026Help
Entry
171026            CDS       T01003                                 

Gene name
Akap5, AKAP150, Akap79, P150
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  
A-kinase anchor protein 5
Organism
rno  Rattus norvegicus (rat)
Brite
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     171026 (Akap5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q24
AA seq 714 aa AA seqDB search
METSVSEIQIETKDEKRPEAASPQKERQERKTATLCFKRRKKVNKKKAKAGSKTAEETKK
HAPEAGGSGQRQPAGAWASIKRLVTHRKPSESAEKQKPSEAEMQPEDGALPKKKTKSKLK
IPCIRFSRGAKRSRPSKLTEDSGYVRVQGEADDLEIKAQIQPDEQATQAKSTQGLQEDVM
VRDGKEIQESHISNNVISGEHVIAIELELEKESSALRMRTPGSEKEAKVILVKQSVQVQQ
ASVLENSAADSPQPVTSTAPLSPATTHQLGLEEPSDSIRESAPSGKDDGRRKTAAEEKKS
GETALGQAEEASSVSQADKSVLSQAEEATVGHTEEATVIQAQSQAKEGKLSQAEEATVAQ
AKETVLSQAEEVKLSQIEEPAISQAKKATVGQAKEAIVSQAEEAIVGHTEKATMGQAEEA
TVGHIEKTTVGQAEEATVGQAEEATVGQAEEATVGQAEEATVGQAEEATVGQAGEATVSH
IEKTTVGQAEEAIVGQAEEATVGQAEEATVGQAEEATVGQAEEATVDQAEEATVGQAEEA
TVGQAGEAAVGQAEEAIVAQAEEATVGQAGEATVGQAEKATVGQAEEPIVGQAEETVLRH
ASDLKVNGVDAEKPRSEESKRMEPIAIIITDTEISEFDVKKSKNVPKQFLISMENEQVGV
FANDSDFEGRTSEQYETLLIETASSLVKNAIELSVEQLVNEMVSEDNQINTLFQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggagaccagcgtttctgagattcaaatcgagactaaggatgagaagagaccagaagca
gccagtcctcagaaagagaggcaggagagaaaaacagccacactgtgcttcaagagaagg
aagaaagtgaacaagaagaaggccaaagctggttccaagactgctgaggagacaaagaag
catgccccagaagctgggggttctggtcagcggcaaccagcgggggcctgggcctccatt
aaacgccttgtgacacacaggaaaccgtccgagtctgcagagaagcagaagccatctgag
gctgaaatgcagcctgaggatggagctcttcctaagaagaagacaaaatccaaacttaag
attccttgcatacgattctcaagaggggcaaagagaagtcgtccttccaaactcacagaa
gattcaggctatgtccgagtccagggagaggcagacgatttggagataaaagcccagatc
cagcccgatgagcaggcaacccaggctaagtccacccagggcctacaggaagatgtgatg
gtgagagatggtaaggagatccaagaatcacacataagcaacaacgtcatatcgggagag
catgtgattgccatagaactggaattagaaaaggaatcttctgctctccggatgagaact
ccagggagtgaaaaggaggctaaagtgattctggtaaagcagagtgttcaggtacagcaa
gcaagtgtgcttgagaattcagcagcagacagccctcagccagtgacttctactgctcct
ctctcaccagcaaccacacatcaactcggtctggaagaacccagtgacagcatccgggaa
agtgcaccaagtggaaaagatgacggaaggagaaagactgctgctgaagaaaagaaatca
ggagagactgcgctgggccaggcagaggaggcttcttcagtcagccaggcagacaaaagt
gtactaagccaggcagaagaagctacagtgggccacacagaggaagctactgtgatccag
gcacagagtcaggcaaaggaaggtaaactgagccaggcagaggaagctacagtggcccag
gcaaaggaaactgtattgagtcaggcagaggaagttaaactgagccagatagaagaacct
gcaattagccaggcaaagaaagctacagtaggacaagcaaaggaagctatagttagccag
gcagaggaagctatagttggtcacacagagaaagccaccatgggtcaggcagaggaagct
acagttggccacatagagaaaaccacagtgggccaggcagaggaagctacagtgggtcaa
gcagaggaagccacagtgggtcaagcagaggaagccacagtgggtcaagcagaggaagct
acagttggacaggcagaggaagctacagttggtcaggcaggggaagctacagttagccac
atagagaaaaccacagtgggccaggcagaggaagctatagttggtcaggcagaggaagcc
acagtgggtcaagcagaggaagccacagtgggtcaagcagaggaagctacagttggccag
gcagaggaagccacagtggatcaagcagaggaagctacagttggccaggcagaggaagct
acagttggtcaggcaggggaagctgcagttggccaggcagaggaagctatagttgctcag
gcagaggaagccacagttggtcaggcaggggaagctacagttggccaagcagagaaagcc
acagttggccaagcagaggaacccatagttggccaggcagaggaaactgtattgaggcat
gcatcagatctgaaagtaaatggagttgatgcagagaaaccaagatcagaagaaagcaaa
agaatggagccaattgctattatcataacagacactgaaatcagtgaatttgatgttaag
aaatctaaaaatgtccctaagcaattcctaatttccatggaaaatgagcaagtgggggtt
tttgctaatgatagtgatttcgaggggagaacttcagaacagtatgaaacactcttaata
gaaacagcttcttctctcgtcaagaatgctatcgagttgtctgtagaacagctggttaac
gaaatggtttctgaggataatcaaataaatacgctgttccagtga

DBGET integrated database retrieval system